Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (08 May 2019)
Sequence version 2 (30 May 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Formimidoyltransferase-cyclodeaminase

Gene

FTCD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.
Binds and promotes bundling of vimentin filaments originating from the Golgi.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

pyridoxal 5'-phosphate

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-histidine degradation into L-glutamate

This protein is involved in step 1 of the subpathway that synthesizes L-glutamate from N-formimidoyl-L-glutamate (transferase route).
Proteins known to be involved in this subpathway in this organism are:
  1. Formimidoyltransferase-cyclodeaminase (FTCD)
This subpathway is part of the pathway L-histidine degradation into L-glutamate, which is itself part of Amino-acid degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-glutamate from N-formimidoyl-L-glutamate (transferase route), the pathway L-histidine degradation into L-glutamate and in Amino-acid degradation.

Pathwayi: tetrahydrofolate interconversion

This protein is involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism.
View all proteins of this organism that are known to be involved in the pathway tetrahydrofolate interconversion and in One-carbon metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei82For formimidoyltransferase activityBy similarity1
Active sitei412For cyclodeaminase activityBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase, Multifunctional enzyme, Transferase
Biological processHistidine metabolism
LigandFolate-binding, Pyridoxal phosphate

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.1.2.5 2681
4.3.1.4 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-70921 Histidine catabolism

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00193
UPA00379;UER00555

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formimidoyltransferase-cyclodeaminase
Alternative name(s):
Formiminotransferase-cyclodeaminase
Short name:
FTCD
LCHC1
Including the following 2 domains:
Glutamate formimidoyltransferase (EC:2.1.2.5)
Alternative name(s):
Glutamate formiminotransferase
Glutamate formyltransferase
Formimidoyltetrahydrofolate cyclodeaminase (EC:4.3.1.4)
Alternative name(s):
Formiminotetrahydrofolate cyclodeaminase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FTCD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3974 FTCD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606806 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95954

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Glutamate formiminotransferase deficiency (FIGLU-URIA)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAutosomal recessive disorder. Features of a severe phenotype, include elevated levels of formiminoglutamate (FIGLU) in the urine in response to histidine administration, megaloblastic anemia, and mental retardation. Features of a mild phenotype include high urinary excretion of FIGLU in the absence of histidine administration, mild developmental delay, and no hematological abnormalities.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_015887135R → C in FIGLU-URIA; mild phenotype; 61% wild-type activity. 1 PublicationCorresponds to variant dbSNP:rs28941768EnsemblClinVar.1
Natural variantiVAR_015888299R → P in FIGLU-URIA; mild phenotype; 57% wild-type activity. 1 PublicationCorresponds to variant dbSNP:rs119469015EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10841

MalaCards human disease database

More...
MalaCardsi
FTCD
MIMi229100 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000160282

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
51208 Formiminoglutamic aciduria

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28391

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB03256 (6R)-Folinic acid
DB00142 L-Glutamic Acid
DB00114 Pyridoxal Phosphate
DB00116 Tetrahydrofolic acid

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FTCD

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000873591 – 541Formimidoyltransferase-cyclodeaminaseAdd BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei316PhosphoserineCombined sources1
Modified residuei386PhosphoserineCombined sources1
Modified residuei520PhosphoserineBy similarity1
Isoform C (identifier: O95954-2)
Modified residuei549PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95954

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95954

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95954

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95954

PeptideAtlas

More...
PeptideAtlasi
O95954

PRoteomics IDEntifications database

More...
PRIDEi
O95954

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51142
51143 [O95954-2]
51144 [O95954-3]
51145 [O95954-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95954

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95954

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160282 Expressed in 154 organ(s), highest expression level in right lobe of liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95954 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95954 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA020073
HPA030928
HPA030929
HPA036114

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooctamer, including four polyglutamate binding sites. The subunits are arranged as a tetramer of dimers, and form a planar ring-shaped structure (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116053, 5 interactors

Protein interaction database and analysis system

More...
IntActi
O95954, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000291670

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95954

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 181Formiminotransferase N-subdomainBy similarityAdd BLAST181
Regioni182 – 326Formiminotransferase C-subdomainBy similarityAdd BLAST145
Regioni327 – 334LinkerBy similarity8
Regioni335 – 541Cyclodeaminase/cyclohydrolaseBy similarityAdd BLAST207

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the C-terminal section; belongs to the cyclodeaminase/cyclohydrolase family.Curated
In the N-terminal section; belongs to the formiminotransferase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IERX Eukaryota
COG3404 LUCA
COG3643 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005581

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95954

KEGG Orthology (KO)

More...
KOi
K13990

Identification of Orthologs from Complete Genome Data

More...
OMAi
YGKRQFE

Database of Orthologous Groups

More...
OrthoDBi
1063278at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95954

TreeFam database of animal gene trees

More...
TreeFami
TF333892

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.680, 1 hit
3.30.70.670, 1 hit
3.30.990.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007044 Cyclodeamin/CycHdrlase
IPR013802 Formiminotransferase_C
IPR037070 Formiminotransferase_C_sf
IPR004227 Formiminotransferase_cat
IPR012886 Formiminotransferase_N
IPR037064 Formiminotransferase_N_sf
IPR022384 FormiminoTrfase_cat_dom_sf
IPR036178 Formintransfe-cycloase-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02971 FTCD, 1 hit
PF04961 FTCD_C, 1 hit
PF07837 FTCD_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01221 FTCD, 1 hit
SM01222 FTCD_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101262 SSF101262, 1 hit
SSF55116 SSF55116, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02024 FtcD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: O95954-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQLVECVPN FSEGKNQEVI DAISGAITQT PGCVLLDVDA GPSTNRTVYT
60 70 80 90 100
FVGPPECVVE GALNAARVAS RLIDMSRHQG EHPRMGALDV CPFIPVRGVS
110 120 130 140 150
VDECVLCAQA FGQRLAEELD VPVYLYGEAA RMDSRRTLPA IRAGEYEALP
160 170 180 190 200
KKLQQADWAP DFGPSSFVPS WGATATGARK FLIAFNINLL GTKEQAHRIA
210 220 230 240 250
LNLREQGRGK DQPGRLKKVQ GIGWYLDEKN LAQVSTNLLD FEVTALHTVY
260 270 280 290 300
EETCREAQEL SLPVVGSQLV GLVPLKALLD AAAFYCEKEN LFILEEEQRI
310 320 330 340 350
RLVVSRLGLD SLCPFSPKER IIEYLVPERG PERGLGSKSL RAFVGEVGAR
360 370 380 390 400
SAAPGGGSVA AAAAAMGAAL GSMVGLMTYG RRQFQSLDTT MRRLIPPFRE
410 420 430 440 450
ASAKLTTLVD ADAEAFTAYL EAMRLPKNTP EEKDRRTAAL QEGLRRAVSV
460 470 480 490 500
PLTLAETVAS LWPALQELAR CGNLACRSDL QVAAKALEMG VFGAYFNVLI
510 520 530 540
NLRDITDEAF KDQIHHRVSS LLQEAKTQAA LVLDCLETRQ E
Length:541
Mass (Da):58,927
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC6CFEBFC6DC2ED68
GO
Isoform C (identifier: O95954-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     514-541: IHHRVSSLLQEAKTQAALVLDCLETRQE → PPAGSQDPGC...GTAGPSTLEG

Show »
Length:572
Mass (Da):61,276
Checksum:i487A7518726BF2DF
GO
Isoform D (identifier: O95954-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     421-541: EAMRLPKNTP...VLDCLETRQE → AHGGPTGGSE...QPEGHHRRGI

Show »
Length:495
Mass (Da):52,765
Checksum:i2A1ECD587F8E8882
GO
Isoform E (identifier: O95954-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-158: VYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADW → GLTAGLSCSLPVRRGSQDGQSPDPAGHPGRGVRGPP
     159-541: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:158
Mass (Da):16,503
Checksum:iE03CA7F616A1023A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7WPK3B7WPK3_HUMAN
Formimidoyltransferase-cyclodeamina...
FTCD
495Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C315H7C315_HUMAN
Formimidoyltransferase-cyclodeamina...
FTCD
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JQF2A0A0G2JQF2_HUMAN
Formimidoyltransferase-cyclodeamina...
FTCD
420Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_015887135R → C in FIGLU-URIA; mild phenotype; 61% wild-type activity. 1 PublicationCorresponds to variant dbSNP:rs28941768EnsemblClinVar.1
Natural variantiVAR_015888299R → P in FIGLU-URIA; mild phenotype; 57% wild-type activity. 1 PublicationCorresponds to variant dbSNP:rs119469015EnsemblClinVar.1
Natural variantiVAR_015889438A → E1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_004257123 – 158VYLYG…QQADW → GLTAGLSCSLPVRRGSQDGQ SPDPAGHPGRGVRGPP in isoform E. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_004258159 – 541Missing in isoform E. 1 PublicationAdd BLAST383
Alternative sequenceiVSP_004259421 – 541EAMRL…ETRQE → AHGGPTGGSEAGSLCAADAG GDGGLAVAGAAGTGPVWEPG LPVRPPGGGQSPGDGRVWRI FQRAHQPEGHHRRGI in isoform D. 1 PublicationAdd BLAST121
Alternative sequenceiVSP_004260514 – 541IHHRV…ETRQE → PPAGSQDPGCTGAGLLGDPA GVTVREASPGSVAPPSPIPR GQSCDLETPGTAGPSTLEG in isoform C. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF169017 mRNA Translation: AAF15558.1
AF289021 mRNA Translation: AAG01852.1
AF289022 mRNA Translation: AAG01853.1
AF289023 mRNA Translation: AAG01854.1
AF289024 mRNA Translation: AAG01855.1
BC052248 mRNA Translation: AAH52248.2
BC136383 mRNA Translation: AAI36384.1
BC136395 mRNA Translation: AAI36396.1
U91541 mRNA Translation: AAD15627.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13731.1 [O95954-1]
CCDS82684.1 [O95954-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001307341.1, NM_001320412.1 [O95954-2]
NP_006648.1, NM_006657.2 [O95954-1]
NP_996848.1, NM_206965.1 [O95954-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000291670; ENSP00000291670; ENSG00000160282 [O95954-1]
ENST00000397746; ENSP00000380854; ENSG00000160282 [O95954-1]
ENST00000397748; ENSP00000380856; ENSG00000160282 [O95954-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10841

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10841

UCSC genome browser

More...
UCSCi
uc002zif.3 human [O95954-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169017 mRNA Translation: AAF15558.1
AF289021 mRNA Translation: AAG01852.1
AF289022 mRNA Translation: AAG01853.1
AF289023 mRNA Translation: AAG01854.1
AF289024 mRNA Translation: AAG01855.1
BC052248 mRNA Translation: AAH52248.2
BC136383 mRNA Translation: AAI36384.1
BC136395 mRNA Translation: AAI36396.1
U91541 mRNA Translation: AAD15627.1
CCDSiCCDS13731.1 [O95954-1]
CCDS82684.1 [O95954-2]
RefSeqiNP_001307341.1, NM_001320412.1 [O95954-2]
NP_006648.1, NM_006657.2 [O95954-1]
NP_996848.1, NM_206965.1 [O95954-1]

3D structure databases

SMRiO95954
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116053, 5 interactors
IntActiO95954, 5 interactors
STRINGi9606.ENSP00000291670

Chemistry databases

DrugBankiDB03256 (6R)-Folinic acid
DB00142 L-Glutamic Acid
DB00114 Pyridoxal Phosphate
DB00116 Tetrahydrofolic acid

PTM databases

iPTMnetiO95954
PhosphoSitePlusiO95954

Polymorphism and mutation databases

BioMutaiFTCD

Proteomic databases

EPDiO95954
jPOSTiO95954
MaxQBiO95954
PaxDbiO95954
PeptideAtlasiO95954
PRIDEiO95954
ProteomicsDBi51142
51143 [O95954-2]
51144 [O95954-3]
51145 [O95954-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000291670; ENSP00000291670; ENSG00000160282 [O95954-1]
ENST00000397746; ENSP00000380854; ENSG00000160282 [O95954-1]
ENST00000397748; ENSP00000380856; ENSG00000160282 [O95954-2]
GeneIDi10841
KEGGihsa:10841
UCSCiuc002zif.3 human [O95954-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10841
DisGeNETi10841

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FTCD
HGNCiHGNC:3974 FTCD
HPAiHPA020073
HPA030928
HPA030929
HPA036114
MalaCardsiFTCD
MIMi229100 phenotype
606806 gene
neXtProtiNX_O95954
OpenTargetsiENSG00000160282
Orphaneti51208 Formiminoglutamic aciduria
PharmGKBiPA28391

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IERX Eukaryota
COG3404 LUCA
COG3643 LUCA
GeneTreeiENSGT00390000005581
InParanoidiO95954
KOiK13990
OMAiYGKRQFE
OrthoDBi1063278at2759
PhylomeDBiO95954
TreeFamiTF333892

Enzyme and pathway databases

UniPathwayiUPA00193
UPA00379;UER00555
BRENDAi2.1.2.5 2681
4.3.1.4 2681
ReactomeiR-HSA-70921 Histidine catabolism

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FTCD human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10841

Protein Ontology

More...
PROi
PR:O95954

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160282 Expressed in 154 organ(s), highest expression level in right lobe of liver
ExpressionAtlasiO95954 baseline and differential
GenevisibleiO95954 HS

Family and domain databases

Gene3Di1.20.120.680, 1 hit
3.30.70.670, 1 hit
3.30.990.10, 1 hit
InterProiView protein in InterPro
IPR007044 Cyclodeamin/CycHdrlase
IPR013802 Formiminotransferase_C
IPR037070 Formiminotransferase_C_sf
IPR004227 Formiminotransferase_cat
IPR012886 Formiminotransferase_N
IPR037064 Formiminotransferase_N_sf
IPR022384 FormiminoTrfase_cat_dom_sf
IPR036178 Formintransfe-cycloase-like_sf
PfamiView protein in Pfam
PF02971 FTCD, 1 hit
PF04961 FTCD_C, 1 hit
PF07837 FTCD_N, 1 hit
SMARTiView protein in SMART
SM01221 FTCD, 1 hit
SM01222 FTCD_N, 1 hit
SUPFAMiSSF101262 SSF101262, 1 hit
SSF55116 SSF55116, 2 hits
TIGRFAMsiTIGR02024 FtcD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFTCD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95954
Secondary accession number(s): B9EGD0
, Q86V03, Q9HCT4, Q9HCT5, Q9HCT6, Q9UHJ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: May 8, 2019
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again