Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eppin

Gene

EPPIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.2 Publications

Miscellaneous

Might be used as a target for male contraception.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAntimicrobial, Protease inhibitor, Serine protease inhibitor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6803157 Antimicrobial peptides

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I02.058

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Eppin
Alternative name(s):
Cancer/testis antigen 71
Short name:
CT71
Epididymal protease inhibitor
Protease inhibitor WAP7
Serine protease inhibitor-like with Kunitz and WAP domains 1
WAP four-disulfide core domain protein 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPPIN
Synonyms:SPINLW1, WAP7, WFDC7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000101448.13
HostDB:ENSG00000249139.1

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15932 EPPIN
HGNC:38825 EPPIN-WFDC6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609031 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95925

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi87L → G: Loss of effect on KLK3 activity. 1 Publication1
Mutagenesisi102C → A: Reduces the binding to SEMG1 by 45%. 1 Publication1
Mutagenesisi107Y → A: Reduces the binding to SEMG1 by 68%. 1 Publication1
Mutagenesisi110C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-123 and A-127. 1 Publication1
Mutagenesisi117F → A: Reduces the binding to SEMG1 by 68% and to LTF by 73%. 1 Publication1
Mutagenesisi123C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-110 and A-127. 1 Publication1
Mutagenesisi127C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-110 and A-123. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
57119

Open Targets

More...
OpenTargetsi
ENSG00000101448
ENSG00000249139

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38054

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EPPIN

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004137822 – 133EppinAdd BLAST112

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi33 ↔ 61By similarity
Disulfide bondi40 ↔ 65By similarity
Disulfide bondi48 ↔ 60By similarity
Disulfide bondi54 ↔ 69By similarity
Disulfide bondi77 ↔ 127By similarity
Disulfide bondi86 ↔ 110By similarity
Disulfide bondi102 ↔ 123By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95925

PeptideAtlas

More...
PeptideAtlasi
O95925

PRoteomics IDEntifications database

More...
PRIDEi
O95925

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51127
51128 [O95925-2]
51129 [O95925-3]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial cells and covers the surface of epididymal spermatozoa and ciliated epithelial cells (at protein level). Expressed specifically in epididymis and testis. Isoform 2 is expressed only in the epididymis. Weak expression is detected in myoid cells as well as spermatogenic cells.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101448 Expressed in 67 organ(s), highest expression level in corpus epididymis

CleanEx database of gene expression profiles

More...
CleanExi
HS_SPINLW1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95925 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95925 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Homodimer. Homomultimers. Interacts with SEMG1 (via 164-283 AA). Interacts with LTF. Found in a complex with LTF, CLU, EPPIN and SEMG1.4 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121383, 4 interactors

Protein interaction database and analysis system

More...
IntActi
O95925, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000452085

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95925

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95925

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 73WAPPROSITE-ProRule annotationAdd BLAST48
Domaini77 – 127BPTI/Kunitz inhibitorPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni102 – 133Interaction with SEMG1Add BLAST32
Regioni117 – 133Interaction with LTF1 PublicationAdd BLAST17

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The BPTI/Kunitz inhibitor domain is required for elastase inhibitory activity. BPTI/Kunitz inhibitor and WAP domains are involved in the protein antibacterial activity.1 Publication

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4295 Eukaryota
ENOG410XQNP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156753

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000115819

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004024

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95925

Identification of Orthologs from Complete Genome Data

More...
OMAi
CCVFNCG

Database of Orthologous Groups

More...
OrthoDBi
1474897at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95925

TreeFam database of animal gene trees

More...
TreeFami
TF342459

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00109 KU, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.410.10, 1 hit
4.10.75.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036645 Elafin-like_sf
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008197 WAP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00014 Kunitz_BPTI, 1 hit
PF00095 WAP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00759 BASICPTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00131 KU, 1 hit
SM00217 WAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57256 SSF57256, 1 hit
SSF57362 SSF57362, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00280 BPTI_KUNITZ_1, 1 hit
PS50279 BPTI_KUNITZ_2, 1 hit
PS51390 WAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95925-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSSGLLSLL VLFVLLANVQ GPGLTDWLFP RRCPKIREEC EFQERDVCTK
60 70 80 90 100
DRQCQDNKKC CVFSCGKKCL DLKQDVCEMP KETGPCLAYF LHWWYDKKDN
110 120 130
TCSMFVYGGC QGNNNNFQSK ANCLNTCKNK RFP
Length:133
Mass (Da):15,284
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF7831B203366D9DC
GO
Isoform 2 (identifier: O95925-2) [UniParc]FASTAAdd to basket
Also known as: Eppin-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGSSGLLSLLVLFVLLANVQGPGLTDWLFPR → MLSKAHGCKTALSLG

Note: Lacks a cleavable signal sequence.
Show »
Length:117
Mass (Da):13,486
Checksum:i96161FAB3CFEDB47
GO
Isoform 3 (identifier: O95925-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-133: RFP → QPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKASLST

Note: Based on a readthrough transcript which may produce a EPPIN-WFDC6 fusion protein. No experimental confirmation available.
Show »
Length:179
Mass (Da):20,486
Checksum:iAD2399D2093D0197
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZBA9B7ZBA9_HUMAN
Eppin
EPPIN
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02469692H → R. Corresponds to variant dbSNP:rs2231838Ensembl.1
Natural variantiVAR_052950128K → T. Corresponds to variant dbSNP:rs2231839Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0067551 – 31MGSSG…WLFPR → MLSKAHGCKTALSLG in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_043679131 – 133RFP → QPCPKIKVECEVEEIDQCTK PRDCPENMKCCPFSRGKKCL DFRKASLST in isoform 3. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF286368 mRNA Translation: AAG00546.1
AF286369 mRNA Translation: AAG00547.1
AF286370 mRNA Translation: AAG00548.1
AL118493 mRNA Translation: CAB56343.1
AK301937 mRNA Translation: BAG63357.1
AL031663 Genomic DNA No translation available.
BC044829 mRNA Translation: AAH44829.2
BC053369 mRNA Translation: AAH53369.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13359.1 [O95925-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001185915.1, NM_001198986.1 [O95925-3]
NP_001289790.1, NM_001302861.1
NP_065131.1, NM_020398.3 [O95925-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.121084
Hs.274876

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336443; ENSP00000338114; ENSG00000101448 [O95925-2]
ENST00000354280; ENSP00000361746; ENSG00000101448 [O95925-1]
ENST00000504988; ENSP00000424176; ENSG00000249139 [O95925-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100526773
57119

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100526773
hsa:57119

UCSC genome browser

More...
UCSCi
uc002xou.4 human [O95925-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286368 mRNA Translation: AAG00546.1
AF286369 mRNA Translation: AAG00547.1
AF286370 mRNA Translation: AAG00548.1
AL118493 mRNA Translation: CAB56343.1
AK301937 mRNA Translation: BAG63357.1
AL031663 Genomic DNA No translation available.
BC044829 mRNA Translation: AAH44829.2
BC053369 mRNA Translation: AAH53369.1
CCDSiCCDS13359.1 [O95925-1]
RefSeqiNP_001185915.1, NM_001198986.1 [O95925-3]
NP_001289790.1, NM_001302861.1
NP_065131.1, NM_020398.3 [O95925-1]
UniGeneiHs.121084
Hs.274876

3D structure databases

ProteinModelPortaliO95925
SMRiO95925
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121383, 4 interactors
IntActiO95925, 1 interactor
STRINGi9606.ENSP00000452085

Protein family/group databases

MEROPSiI02.058

Polymorphism and mutation databases

BioMutaiEPPIN

Proteomic databases

PaxDbiO95925
PeptideAtlasiO95925
PRIDEiO95925
ProteomicsDBi51127
51128 [O95925-2]
51129 [O95925-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57119
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336443; ENSP00000338114; ENSG00000101448 [O95925-2]
ENST00000354280; ENSP00000361746; ENSG00000101448 [O95925-1]
ENST00000504988; ENSP00000424176; ENSG00000249139 [O95925-3]
GeneIDi100526773
57119
KEGGihsa:100526773
hsa:57119
UCSCiuc002xou.4 human [O95925-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100526773
57119
DisGeNETi57119
EuPathDBiHostDB:ENSG00000101448.13
HostDB:ENSG00000249139.1

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EPPIN
EPPIN-WFDC6
HGNCiHGNC:15932 EPPIN
HGNC:38825 EPPIN-WFDC6
MIMi609031 gene
neXtProtiNX_O95925
OpenTargetsiENSG00000101448
ENSG00000249139
PharmGKBiPA38054

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4295 Eukaryota
ENOG410XQNP LUCA
GeneTreeiENSGT00940000156753
HOGENOMiHOG000115819
HOVERGENiHBG004024
InParanoidiO95925
OMAiCCVFNCG
OrthoDBi1474897at2759
PhylomeDBiO95925
TreeFamiTF342459

Enzyme and pathway databases

ReactomeiR-HSA-6803157 Antimicrobial peptides

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SPINLW1

Protein Ontology

More...
PROi
PR:O95925

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101448 Expressed in 67 organ(s), highest expression level in corpus epididymis
CleanExiHS_SPINLW1
ExpressionAtlasiO95925 baseline and differential
GenevisibleiO95925 HS

Family and domain databases

CDDicd00109 KU, 1 hit
Gene3Di4.10.410.10, 1 hit
4.10.75.10, 1 hit
InterProiView protein in InterPro
IPR036645 Elafin-like_sf
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008197 WAP_dom
PfamiView protein in Pfam
PF00014 Kunitz_BPTI, 1 hit
PF00095 WAP, 1 hit
PRINTSiPR00759 BASICPTASE
SMARTiView protein in SMART
SM00131 KU, 1 hit
SM00217 WAP, 1 hit
SUPFAMiSSF57256 SSF57256, 1 hit
SSF57362 SSF57362, 1 hit
PROSITEiView protein in PROSITE
PS00280 BPTI_KUNITZ_1, 1 hit
PS50279 BPTI_KUNITZ_2, 1 hit
PS51390 WAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEPPI_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95925
Secondary accession number(s): A6PVD6
, Q86TP9, Q96SD7, Q9HD30
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: May 1, 1999
Last modified: January 16, 2019
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again