Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eppin

Gene

EPPIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.2 Publications

Miscellaneous

Might be used as a target for male contraception.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAntimicrobial, Protease inhibitor, Serine protease inhibitor

Enzyme and pathway databases

ReactomeiR-HSA-6803157 Antimicrobial peptides

Protein family/group databases

MEROPSiI02.058

Names & Taxonomyi

Protein namesi
Recommended name:
Eppin
Alternative name(s):
Cancer/testis antigen 71
Short name:
CT71
Epididymal protease inhibitor
Protease inhibitor WAP7
Serine protease inhibitor-like with Kunitz and WAP domains 1
WAP four-disulfide core domain protein 7
Gene namesi
Name:EPPIN
Synonyms:SPINLW1, WAP7, WFDC7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000101448.13
HostDB:ENSG00000249139.1
HGNCiHGNC:15932 EPPIN
HGNC:38825 EPPIN-WFDC6
MIMi609031 gene
neXtProtiNX_O95925

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi87L → G: Loss of effect on KLK3 activity. 1 Publication1
Mutagenesisi102C → A: Reduces the binding to SEMG1 by 45%. 1 Publication1
Mutagenesisi107Y → A: Reduces the binding to SEMG1 by 68%. 1 Publication1
Mutagenesisi110C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-123 and A-127. 1 Publication1
Mutagenesisi117F → A: Reduces the binding to SEMG1 by 68% and to LTF by 73%. 1 Publication1
Mutagenesisi123C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-110 and A-127. 1 Publication1
Mutagenesisi127C → A: Does not affect the binding of SEMG1 or LTF. Does not affect the binding of SEMG1; when associated with A-110 and A-123. 1 Publication1

Organism-specific databases

DisGeNETi57119
OpenTargetsiENSG00000101448
ENSG00000249139
PharmGKBiPA38054

Polymorphism and mutation databases

BioMutaiEPPIN

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000004137822 – 133EppinAdd BLAST112

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi33 ↔ 61By similarity
Disulfide bondi40 ↔ 65By similarity
Disulfide bondi48 ↔ 60By similarity
Disulfide bondi54 ↔ 69By similarity
Disulfide bondi77 ↔ 127By similarity
Disulfide bondi86 ↔ 110By similarity
Disulfide bondi102 ↔ 123By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiO95925
PeptideAtlasiO95925
PRIDEiO95925
ProteomicsDBi51127
51128 [O95925-2]
51129 [O95925-3]

Expressioni

Tissue specificityi

In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial cells and covers the surface of epididymal spermatozoa and ciliated epithelial cells (at protein level). Expressed specifically in epididymis and testis. Isoform 2 is expressed only in the epididymis. Weak expression is detected in myoid cells as well as spermatogenic cells.2 Publications

Gene expression databases

BgeeiENSG00000101448 Expressed in 67 organ(s), highest expression level in corpus epididymis
CleanExiHS_SPINLW1
ExpressionAtlasiO95925 baseline and differential
GenevisibleiO95925 HS

Interactioni

Subunit structurei

Monomer. Homodimer. Homomultimers. Interacts with SEMG1 (via 164-283 AA). Interacts with LTF. Found in a complex with LTF, CLU, EPPIN and SEMG1.4 Publications

Protein-protein interaction databases

BioGridi121383, 4 interactors
IntActiO95925, 1 interactor
STRINGi9606.ENSP00000452085

Structurei

3D structure databases

ProteinModelPortaliO95925
SMRiO95925
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 73WAPPROSITE-ProRule annotationAdd BLAST48
Domaini77 – 127BPTI/Kunitz inhibitorPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni102 – 133Interaction with SEMG1Add BLAST32
Regioni117 – 133Interaction with LTF1 PublicationAdd BLAST17

Domaini

The BPTI/Kunitz inhibitor domain is required for elastase inhibitory activity. BPTI/Kunitz inhibitor and WAP domains are involved in the protein antibacterial activity.1 Publication

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG4295 Eukaryota
ENOG410XQNP LUCA
GeneTreeiENSGT00730000110932
HOGENOMiHOG000115819
HOVERGENiHBG004024
InParanoidiO95925
OMAiCCVFNCG
OrthoDBiEOG091G09P2
PhylomeDBiO95925
TreeFamiTF342459

Family and domain databases

CDDicd00109 KU, 1 hit
Gene3Di4.10.410.10, 1 hit
4.10.75.10, 1 hit
InterProiView protein in InterPro
IPR036645 Elafin-like_sf
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008197 WAP_dom
PfamiView protein in Pfam
PF00014 Kunitz_BPTI, 1 hit
PF00095 WAP, 1 hit
PRINTSiPR00759 BASICPTASE
SMARTiView protein in SMART
SM00131 KU, 1 hit
SM00217 WAP, 1 hit
SUPFAMiSSF57256 SSF57256, 1 hit
SSF57362 SSF57362, 1 hit
PROSITEiView protein in PROSITE
PS00280 BPTI_KUNITZ_1, 1 hit
PS50279 BPTI_KUNITZ_2, 1 hit
PS51390 WAP, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95925-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSSGLLSLL VLFVLLANVQ GPGLTDWLFP RRCPKIREEC EFQERDVCTK
60 70 80 90 100
DRQCQDNKKC CVFSCGKKCL DLKQDVCEMP KETGPCLAYF LHWWYDKKDN
110 120 130
TCSMFVYGGC QGNNNNFQSK ANCLNTCKNK RFP
Length:133
Mass (Da):15,284
Last modified:May 1, 1999 - v1
Checksum:iF7831B203366D9DC
GO
Isoform 2 (identifier: O95925-2) [UniParc]FASTAAdd to basket
Also known as: Eppin-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGSSGLLSLLVLFVLLANVQGPGLTDWLFPR → MLSKAHGCKTALSLG

Note: Lacks a cleavable signal sequence.
Show »
Length:117
Mass (Da):13,486
Checksum:i96161FAB3CFEDB47
GO
Isoform 3 (identifier: O95925-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-133: RFP → QPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKASLST

Note: Based on a readthrough transcript which may produce a EPPIN-WFDC6 fusion protein. No experimental confirmation available.
Show »
Length:179
Mass (Da):20,486
Checksum:iAD2399D2093D0197
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZBA9B7ZBA9_HUMAN
Eppin
EPPIN
77Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02469692H → R. Corresponds to variant dbSNP:rs2231838Ensembl.1
Natural variantiVAR_052950128K → T. Corresponds to variant dbSNP:rs2231839Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0067551 – 31MGSSG…WLFPR → MLSKAHGCKTALSLG in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_043679131 – 133RFP → QPCPKIKVECEVEEIDQCTK PRDCPENMKCCPFSRGKKCL DFRKASLST in isoform 3. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286368 mRNA Translation: AAG00546.1
AF286369 mRNA Translation: AAG00547.1
AF286370 mRNA Translation: AAG00548.1
AL118493 mRNA Translation: CAB56343.1
AK301937 mRNA Translation: BAG63357.1
AL031663 Genomic DNA No translation available.
BC044829 mRNA Translation: AAH44829.2
BC053369 mRNA Translation: AAH53369.1
CCDSiCCDS13359.1 [O95925-1]
RefSeqiNP_001185915.1, NM_001198986.1 [O95925-3]
NP_001289790.1, NM_001302861.1
NP_065131.1, NM_020398.3 [O95925-1]
UniGeneiHs.121084
Hs.274876

Genome annotation databases

EnsembliENST00000336443; ENSP00000338114; ENSG00000101448 [O95925-2]
ENST00000354280; ENSP00000361746; ENSG00000101448 [O95925-1]
ENST00000504988; ENSP00000424176; ENSG00000249139 [O95925-3]
GeneIDi100526773
57119
KEGGihsa:100526773
hsa:57119
UCSCiuc002xou.4 human [O95925-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286368 mRNA Translation: AAG00546.1
AF286369 mRNA Translation: AAG00547.1
AF286370 mRNA Translation: AAG00548.1
AL118493 mRNA Translation: CAB56343.1
AK301937 mRNA Translation: BAG63357.1
AL031663 Genomic DNA No translation available.
BC044829 mRNA Translation: AAH44829.2
BC053369 mRNA Translation: AAH53369.1
CCDSiCCDS13359.1 [O95925-1]
RefSeqiNP_001185915.1, NM_001198986.1 [O95925-3]
NP_001289790.1, NM_001302861.1
NP_065131.1, NM_020398.3 [O95925-1]
UniGeneiHs.121084
Hs.274876

3D structure databases

ProteinModelPortaliO95925
SMRiO95925
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121383, 4 interactors
IntActiO95925, 1 interactor
STRINGi9606.ENSP00000452085

Protein family/group databases

MEROPSiI02.058

Polymorphism and mutation databases

BioMutaiEPPIN

Proteomic databases

PaxDbiO95925
PeptideAtlasiO95925
PRIDEiO95925
ProteomicsDBi51127
51128 [O95925-2]
51129 [O95925-3]

Protocols and materials databases

DNASUi57119
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336443; ENSP00000338114; ENSG00000101448 [O95925-2]
ENST00000354280; ENSP00000361746; ENSG00000101448 [O95925-1]
ENST00000504988; ENSP00000424176; ENSG00000249139 [O95925-3]
GeneIDi100526773
57119
KEGGihsa:100526773
hsa:57119
UCSCiuc002xou.4 human [O95925-1]

Organism-specific databases

CTDi100526773
57119
DisGeNETi57119
EuPathDBiHostDB:ENSG00000101448.13
HostDB:ENSG00000249139.1
GeneCardsiEPPIN
EPPIN-WFDC6
HGNCiHGNC:15932 EPPIN
HGNC:38825 EPPIN-WFDC6
MIMi609031 gene
neXtProtiNX_O95925
OpenTargetsiENSG00000101448
ENSG00000249139
PharmGKBiPA38054
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4295 Eukaryota
ENOG410XQNP LUCA
GeneTreeiENSGT00730000110932
HOGENOMiHOG000115819
HOVERGENiHBG004024
InParanoidiO95925
OMAiCCVFNCG
OrthoDBiEOG091G09P2
PhylomeDBiO95925
TreeFamiTF342459

Enzyme and pathway databases

ReactomeiR-HSA-6803157 Antimicrobial peptides

Miscellaneous databases

GeneWikiiSPINLW1
PROiPR:O95925
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101448 Expressed in 67 organ(s), highest expression level in corpus epididymis
CleanExiHS_SPINLW1
ExpressionAtlasiO95925 baseline and differential
GenevisibleiO95925 HS

Family and domain databases

CDDicd00109 KU, 1 hit
Gene3Di4.10.410.10, 1 hit
4.10.75.10, 1 hit
InterProiView protein in InterPro
IPR036645 Elafin-like_sf
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008197 WAP_dom
PfamiView protein in Pfam
PF00014 Kunitz_BPTI, 1 hit
PF00095 WAP, 1 hit
PRINTSiPR00759 BASICPTASE
SMARTiView protein in SMART
SM00131 KU, 1 hit
SM00217 WAP, 1 hit
SUPFAMiSSF57256 SSF57256, 1 hit
SSF57362 SSF57362, 1 hit
PROSITEiView protein in PROSITE
PS00280 BPTI_KUNITZ_1, 1 hit
PS50279 BPTI_KUNITZ_2, 1 hit
PS51390 WAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiEPPI_HUMAN
AccessioniPrimary (citable) accession number: O95925
Secondary accession number(s): A6PVD6
, Q86TP9, Q96SD7, Q9HD30
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 157 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again