Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ecdysoneless homolog

Gene

ECD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).2 Publications5 Publications

GO - Molecular functioni

  • histone acetyltransferase binding Source: UniProtKB
  • transcription coactivator activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionActivator
Biological processmRNA processing, mRNA splicing, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ecdysoneless homologBy similarity
Alternative name(s):
Human suppressor of GCR two1 Publication
Short name:
hSGT11 Publication
Gene namesi
Name:ECD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000122882.10
HGNCiHGNC:17029 ECD
MIMi616464 gene
neXtProtiNX_O95905

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi481I → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi484D → F: Decreases transactivation activity. 1 Publication1
Mutagenesisi489L → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi503S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-505, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi505S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi510D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi512D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi518S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi520D → P: Increases transactivation activity. 1 Publication1
Mutagenesisi572S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-579 and A-584. 1 Publication1
Mutagenesisi579S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-584. 1 Publication1
Mutagenesisi584S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-579. 1 Publication1

Organism-specific databases

DisGeNETi11319
OpenTargetsiENSG00000122882
PharmGKBiPA143485450

Polymorphism and mutation databases

BioMutaiECD

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002208441 – 644Protein ecdysoneless homologAdd BLAST644

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei503PhosphoserineCombined sources1
Modified residuei505PhosphoserineCombined sources1
Modified residuei518PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated predominantly by CK2 on two serine-containing clusters; involved in cell cycle regulation activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO95905
MaxQBiO95905
PaxDbiO95905
PeptideAtlasiO95905
PRIDEiO95905
ProteomicsDBi51121

PTM databases

iPTMnetiO95905
PhosphoSitePlusiO95905

Expressioni

Tissue specificityi

Highly expressed in muscle and heart. Over-expressed in pancreatic and breast cancers.2 Publications

Gene expression databases

BgeeiENSG00000122882 Expressed in 219 organ(s), highest expression level in kidney
CleanExiHS_ECD
ExpressionAtlasiO95905 baseline and differential
GenevisibleiO95905 HS

Organism-specific databases

HPAiHPA006465

Interactioni

Subunit structurei

Interacts with TP53, MDM2, TXNIP (PubMed:16849563, PubMed:23880345). Interacts (phosphorylated) with PIH1D1. Interacts with RUVBL1 mediating the PIH1D1-independent association with the R2TP complex (PubMed:24656813, PubMed:26711270). Interacts with RB1, RBL1 and RBL2; ECD competes with E2F1 for binding to hypophospshorylated RB1 (PubMed:19640839). Interacts with EP300 (PubMed:19919181).6 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116450, 69 interactors
IntActiO95905, 34 interactors
STRINGi9606.ENSP00000401566

Structurei

3D structure databases

ProteinModelPortaliO95905
SMRiO95905
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni439 – 644Transcription activation1 PublicationAdd BLAST206
Regioni481 – 497Involved in nuclear export1 PublicationAdd BLAST17
Regioni502 – 532Acidic region required for transactivation activity1 PublicationAdd BLAST31

Sequence similaritiesi

Belongs to the ECD family.Curated

Phylogenomic databases

eggNOGiKOG2406 Eukaryota
ENOG410XR07 LUCA
GeneTreeiENSGT00390000015361
HOGENOMiHOG000029899
HOVERGENiHBG023145
InParanoidiO95905
OMAiHGVTHYG
OrthoDBiEOG091G081H
PhylomeDBiO95905
TreeFamiTF324229

Family and domain databases

InterProiView protein in InterPro
IPR010770 Ecd
PANTHERiPTHR13060 PTHR13060, 1 hit
PfamiView protein in Pfam
PF07093 SGT1, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95905-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEETMKLATM EDTVEYCLFL IPDESRDSDK HKEILQKYIE RIITRFAPML
60 70 80 90 100
VPYIWQNQPF NLKYKPGKGG VPAHMFGVTK FGDNIEDEWF IVYVIKQITK
110 120 130 140 150
EFPELVARIE DNDGEFLLIE AADFLPKWLD PENSTNRVFF CHGELCIIPA
160 170 180 190 200
PRKSGAESWL PTTPPTIPQA LNIITAHSEK ILASESIRAA VNRRIRGYPE
210 220 230 240 250
KIQASLHRAH CFLPAGIVAV LKQRPRLVAA AVQAFYLRDP IDLRACRVFK
260 270 280 290 300
TFLPETRIMT SVTFTKCLYA QLVQQRFVPD RRSGYRLPPP SDPQYRAHEL
310 320 330 340 350
GMKLAHGFEI LCSKCSPHFS DCKKSLVTAS PLWASFLESL KKNDYFKGLI
360 370 380 390 400
EGSAQYRERL EMAENYFQLS VDWPESSLAM SPGEEILTLL QTIPFDIEDL
410 420 430 440 450
KKEAANLPPE DDDQWLDLSP DQLDQLLQEA VGKKESESVS KEEKEQNYDL
460 470 480 490 500
TEVSESMKAF ISKVSTHKGA ELPREPSEAP ITFDADSFLN YFDKILGPRP
510 520 530 540 550
NESDSDDLDD EDFECLDSDD DLDFETHEPG EEASLKGTLD NLKSYMAQMD
560 570 580 590 600
QELAHTCISK SFTTRNQVEP VSQTTDNNSD EEDSGTGESV MAPVDVDLNL
610 620 630 640
VSNILESYSS QAGLAGPASN LLQSMGVQLP DNTDHRPTSK PTKN
Length:644
Mass (Da):72,758
Last modified:May 1, 1999 - v1
Checksum:iF9B0D2BBFDB38CAF
GO
Isoform 2 (identifier: O95905-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-304: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):67,712
Checksum:i4F0AC1D928853E85
GO
Isoform 3 (identifier: O95905-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     375-375: E → ERLEVQWRDPGLLQAPPPGFTPFICLSLLSTWDN

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):76,508
Checksum:i4628E86C662AE075
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J316C9J316_HUMAN
Protein ecdysoneless homolog
ECD
212Annotation score:
F2Z2R1F2Z2R1_HUMAN
Protein ecdysoneless homolog
ECD
163Annotation score:
C9JGV1C9JGV1_HUMAN
Protein ecdysoneless homolog
ECD
217Annotation score:
S4R458S4R458_HUMAN
Protein ecdysoneless homolog
ECD
87Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28S → P in AK225519 (PubMed:14702039).Curated1
Sequence conflicti319F → S in AK225519 (PubMed:14702039).Curated1
Sequence conflicti333W → R in AK225519 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05197045R → Q. Corresponds to variant dbSNP:rs3812619Ensembl.1
Natural variantiVAR_012191281R → G Could be a rare polymorphism. 1 PublicationCorresponds to variant dbSNP:rs151023501Ensembl.1
Natural variantiVAR_051971452E → Q. Corresponds to variant dbSNP:rs3736518Ensembl.1
Natural variantiVAR_051972501N → S. Corresponds to variant dbSNP:rs36152134Ensembl.1
Natural variantiVAR_051973634D → G. Corresponds to variant dbSNP:rs2271904Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045670262 – 304Missing in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045671375E → ERLEVQWRDPGLLQAPPPGF TPFICLSLLSTWDN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88208 mRNA Translation: BAA75199.1
AK315711 mRNA No translation available.
AK225519 mRNA No translation available.
AC016394 Genomic DNA No translation available.
BC000721 mRNA Translation: AAH00721.1
CCDSiCCDS44433.1 [O95905-2]
CCDS44434.1 [O95905-3]
CCDS7321.1 [O95905-1]
RefSeqiNP_001129224.1, NM_001135752.1 [O95905-3]
NP_001129225.1, NM_001135753.1 [O95905-2]
NP_009196.1, NM_007265.2 [O95905-1]
UniGeneiHs.631822

Genome annotation databases

EnsembliENST00000372979; ENSP00000362070; ENSG00000122882 [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882 [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882 [O95905-2]
GeneIDi11319
KEGGihsa:11319
UCSCiuc001jtn.4 human [O95905-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88208 mRNA Translation: BAA75199.1
AK315711 mRNA No translation available.
AK225519 mRNA No translation available.
AC016394 Genomic DNA No translation available.
BC000721 mRNA Translation: AAH00721.1
CCDSiCCDS44433.1 [O95905-2]
CCDS44434.1 [O95905-3]
CCDS7321.1 [O95905-1]
RefSeqiNP_001129224.1, NM_001135752.1 [O95905-3]
NP_001129225.1, NM_001135753.1 [O95905-2]
NP_009196.1, NM_007265.2 [O95905-1]
UniGeneiHs.631822

3D structure databases

ProteinModelPortaliO95905
SMRiO95905
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116450, 69 interactors
IntActiO95905, 34 interactors
STRINGi9606.ENSP00000401566

PTM databases

iPTMnetiO95905
PhosphoSitePlusiO95905

Polymorphism and mutation databases

BioMutaiECD

Proteomic databases

EPDiO95905
MaxQBiO95905
PaxDbiO95905
PeptideAtlasiO95905
PRIDEiO95905
ProteomicsDBi51121

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372979; ENSP00000362070; ENSG00000122882 [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882 [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882 [O95905-2]
GeneIDi11319
KEGGihsa:11319
UCSCiuc001jtn.4 human [O95905-1]

Organism-specific databases

CTDi11319
DisGeNETi11319
EuPathDBiHostDB:ENSG00000122882.10
GeneCardsiECD
HGNCiHGNC:17029 ECD
HPAiHPA006465
MIMi616464 gene
neXtProtiNX_O95905
OpenTargetsiENSG00000122882
PharmGKBiPA143485450
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2406 Eukaryota
ENOG410XR07 LUCA
GeneTreeiENSGT00390000015361
HOGENOMiHOG000029899
HOVERGENiHBG023145
InParanoidiO95905
OMAiHGVTHYG
OrthoDBiEOG091G081H
PhylomeDBiO95905
TreeFamiTF324229

Miscellaneous databases

ChiTaRSiECD human
GeneWikiiECD_(gene)
GenomeRNAii11319
PROiPR:O95905
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122882 Expressed in 219 organ(s), highest expression level in kidney
CleanExiHS_ECD
ExpressionAtlasiO95905 baseline and differential
GenevisibleiO95905 HS

Family and domain databases

InterProiView protein in InterPro
IPR010770 Ecd
PANTHERiPTHR13060 PTHR13060, 1 hit
PfamiView protein in Pfam
PF07093 SGT1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiECD_HUMAN
AccessioniPrimary (citable) accession number: O95905
Secondary accession number(s): C9JX46, E9PAW8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again