Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (16 Oct 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein ecdysoneless homolog

Gene

ECD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).2 Publications5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • histone acetyltransferase binding Source: UniProtKB
  • transcription coactivator activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processmRNA processing, mRNA splicing, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein ecdysoneless homologBy similarity
Alternative name(s):
Human suppressor of GCR two1 Publication
Short name:
hSGT11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ECD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17029 ECD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616464 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95905

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi481I → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi484D → F: Decreases transactivation activity. 1 Publication1
Mutagenesisi489L → A: Decreases transactivation activity. 1 Publication1
Mutagenesisi503S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-505, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi505S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-518, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi510D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi512D → R: Increases transactivation activity. 1 Publication1
Mutagenesisi518S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-572, A-579 and A-584. 1 Publication1
Mutagenesisi520D → P: Increases transactivation activity. 1 Publication1
Mutagenesisi572S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-579 and A-584. 1 Publication1
Mutagenesisi579S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-584. 1 Publication1
Mutagenesisi584S → A: Greatly impairs in vitro phosphorylation by CK2 and impairs cell cycle regulation activity; when associated with A-503, A-505, A-518, A-572 and A-579. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
11319

Open Targets

More...
OpenTargetsi
ENSG00000122882

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485450

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O95905

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ECD

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002208441 – 644Protein ecdysoneless homologAdd BLAST644

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei503PhosphoserineCombined sources1
Modified residuei505PhosphoserineCombined sources1
Modified residuei518PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated predominantly by CK2 on two serine-containing clusters; involved in cell cycle regulation activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95905

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95905

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O95905

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95905

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95905

PeptideAtlas

More...
PeptideAtlasi
O95905

PRoteomics IDEntifications database

More...
PRIDEi
O95905

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
12074
19095
51121 [O95905-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95905

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95905

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in muscle and heart. Over-expressed in pancreatic and breast cancers.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122882 Expressed in 219 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95905 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95905 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006465

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TP53, MDM2, TXNIP (PubMed:16849563, PubMed:23880345).

Interacts (phosphorylated) with PIH1D1.

Interacts with RUVBL1 mediating the PIH1D1-independent association with the R2TP complex (PubMed:24656813, PubMed:26711270).

Interacts with RB1, RBL1 and RBL2; ECD competes with E2F1 for binding to hypophospshorylated RB1 (PubMed:19640839).

Interacts with EP300 (PubMed:19919181).

6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116450, 77 interactors

Protein interaction database and analysis system

More...
IntActi
O95905, 51 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000401566

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95905

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni439 – 644Transcription activation1 PublicationAdd BLAST206
Regioni481 – 497Involved in nuclear export1 PublicationAdd BLAST17
Regioni502 – 532Acidic region required for transactivation activity1 PublicationAdd BLAST31

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ECD family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2406 Eukaryota
ENOG410XR07 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015361

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000029899

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95905

Identification of Orthologs from Complete Genome Data

More...
OMAi
LWHKDEF

Database of Orthologous Groups

More...
OrthoDBi
603336at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95905

TreeFam database of animal gene trees

More...
TreeFami
TF324229

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010770 Ecd

The PANTHER Classification System

More...
PANTHERi
PTHR13060 PTHR13060, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07093 SGT1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95905-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEETMKLATM EDTVEYCLFL IPDESRDSDK HKEILQKYIE RIITRFAPML
60 70 80 90 100
VPYIWQNQPF NLKYKPGKGG VPAHMFGVTK FGDNIEDEWF IVYVIKQITK
110 120 130 140 150
EFPELVARIE DNDGEFLLIE AADFLPKWLD PENSTNRVFF CHGELCIIPA
160 170 180 190 200
PRKSGAESWL PTTPPTIPQA LNIITAHSEK ILASESIRAA VNRRIRGYPE
210 220 230 240 250
KIQASLHRAH CFLPAGIVAV LKQRPRLVAA AVQAFYLRDP IDLRACRVFK
260 270 280 290 300
TFLPETRIMT SVTFTKCLYA QLVQQRFVPD RRSGYRLPPP SDPQYRAHEL
310 320 330 340 350
GMKLAHGFEI LCSKCSPHFS DCKKSLVTAS PLWASFLESL KKNDYFKGLI
360 370 380 390 400
EGSAQYRERL EMAENYFQLS VDWPESSLAM SPGEEILTLL QTIPFDIEDL
410 420 430 440 450
KKEAANLPPE DDDQWLDLSP DQLDQLLQEA VGKKESESVS KEEKEQNYDL
460 470 480 490 500
TEVSESMKAF ISKVSTHKGA ELPREPSEAP ITFDADSFLN YFDKILGPRP
510 520 530 540 550
NESDSDDLDD EDFECLDSDD DLDFETHEPG EEASLKGTLD NLKSYMAQMD
560 570 580 590 600
QELAHTCISK SFTTRNQVEP VSQTTDNNSD EEDSGTGESV MAPVDVDLNL
610 620 630 640
VSNILESYSS QAGLAGPASN LLQSMGVQLP DNTDHRPTSK PTKN
Length:644
Mass (Da):72,758
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF9B0D2BBFDB38CAF
GO
Isoform 2 (identifier: O95905-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-304: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):67,712
Checksum:i4F0AC1D928853E85
GO
Isoform 3 (identifier: O95905-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     375-375: E → ERLEVQWRDPGLLQAPPPGFTPFICLSLLSTWDN

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):76,508
Checksum:i4628E86C662AE075
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J316C9J316_HUMAN
Protein ecdysoneless homolog
ECD
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2R1F2Z2R1_HUMAN
Protein ecdysoneless homolog
ECD
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JGV1C9JGV1_HUMAN
Protein ecdysoneless homolog
ECD
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R458S4R458_HUMAN
Protein ecdysoneless homolog
ECD
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28S → P in AK225519 (PubMed:14702039).Curated1
Sequence conflicti319F → S in AK225519 (PubMed:14702039).Curated1
Sequence conflicti333W → R in AK225519 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05197045R → Q. Corresponds to variant dbSNP:rs3812619Ensembl.1
Natural variantiVAR_012191281R → G Could be a rare polymorphism. 1 PublicationCorresponds to variant dbSNP:rs151023501Ensembl.1
Natural variantiVAR_051971452E → Q. Corresponds to variant dbSNP:rs3736518Ensembl.1
Natural variantiVAR_051972501N → S. Corresponds to variant dbSNP:rs36152134Ensembl.1
Natural variantiVAR_051973634D → G. Corresponds to variant dbSNP:rs2271904Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045670262 – 304Missing in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_045671375E → ERLEVQWRDPGLLQAPPPGF TPFICLSLLSTWDN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D88208 mRNA Translation: BAA75199.1
AK315711 mRNA No translation available.
AK225519 mRNA No translation available.
AC016394 Genomic DNA No translation available.
BC000721 mRNA Translation: AAH00721.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44433.1 [O95905-2]
CCDS44434.1 [O95905-3]
CCDS7321.1 [O95905-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129224.1, NM_001135752.1 [O95905-3]
NP_001129225.1, NM_001135753.1 [O95905-2]
NP_009196.1, NM_007265.2 [O95905-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372979; ENSP00000362070; ENSG00000122882 [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882 [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882 [O95905-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11319

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11319

UCSC genome browser

More...
UCSCi
uc001jtn.4 human [O95905-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D88208 mRNA Translation: BAA75199.1
AK315711 mRNA No translation available.
AK225519 mRNA No translation available.
AC016394 Genomic DNA No translation available.
BC000721 mRNA Translation: AAH00721.1
CCDSiCCDS44433.1 [O95905-2]
CCDS44434.1 [O95905-3]
CCDS7321.1 [O95905-1]
RefSeqiNP_001129224.1, NM_001135752.1 [O95905-3]
NP_001129225.1, NM_001135753.1 [O95905-2]
NP_009196.1, NM_007265.2 [O95905-1]

3D structure databases

SMRiO95905
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116450, 77 interactors
IntActiO95905, 51 interactors
STRINGi9606.ENSP00000401566

PTM databases

iPTMnetiO95905
PhosphoSitePlusiO95905

Polymorphism and mutation databases

BioMutaiECD

Proteomic databases

EPDiO95905
jPOSTiO95905
MassIVEiO95905
MaxQBiO95905
PaxDbiO95905
PeptideAtlasiO95905
PRIDEiO95905
ProteomicsDBi12074
19095
51121 [O95905-1]

Genome annotation databases

EnsembliENST00000372979; ENSP00000362070; ENSG00000122882 [O95905-1]
ENST00000430082; ENSP00000401566; ENSG00000122882 [O95905-3]
ENST00000454759; ENSP00000395786; ENSG00000122882 [O95905-2]
GeneIDi11319
KEGGihsa:11319
UCSCiuc001jtn.4 human [O95905-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11319
DisGeNETi11319

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ECD
HGNCiHGNC:17029 ECD
HPAiHPA006465
MIMi616464 gene
neXtProtiNX_O95905
OpenTargetsiENSG00000122882
PharmGKBiPA143485450

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2406 Eukaryota
ENOG410XR07 LUCA
GeneTreeiENSGT00390000015361
HOGENOMiHOG000029899
InParanoidiO95905
OMAiLWHKDEF
OrthoDBi603336at2759
PhylomeDBiO95905
TreeFamiTF324229

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ECD human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ECD_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11319
PharosiO95905

Protein Ontology

More...
PROi
PR:O95905

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000122882 Expressed in 219 organ(s), highest expression level in kidney
ExpressionAtlasiO95905 baseline and differential
GenevisibleiO95905 HS

Family and domain databases

InterProiView protein in InterPro
IPR010770 Ecd
PANTHERiPTHR13060 PTHR13060, 1 hit
PfamiView protein in Pfam
PF07093 SGT1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiECD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95905
Secondary accession number(s): C9JX46, E9PAW8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 1999
Last modified: October 16, 2019
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again