Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (16 Jan 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Megakaryocyte and platelet inhibitory receptor G6b

Gene

MPIG6B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PubMed:12665801, PubMed:17311996, PubMed:27743390). Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide (PubMed:12665801). This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling (PubMed:17311996). Appears to operate in a calcium-independent manner (PubMed:12665801).3 Publications
Isoform B, displayed in this entry, is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHeparin-binding, Receptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-114604 GPVI-mediated activation cascade

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Megakaryocyte and platelet inhibitory receptor G6bImported
Alternative name(s):
Protein G6bCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPIG6BImported
Synonyms:C6orf25Imported, G6BImported, G6B-B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204420.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13937 MPIG6B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606520 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95866

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini18 – 142Extracellular1 PublicationSequence analysisAdd BLAST125
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei143 – 163HelicalSequence analysisAdd BLAST21
Topological domaini164 – 241Cytoplasmic1 PublicationSequence analysisAdd BLAST78

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Thrombocytopenia, anemia, and myelofibrosis (THAMY)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by thrombocytopenia, increased number of giant platelets, and anemia manifesting in early childhood. Bone marrow biopsy shows increased number of megakaryocytes and reticular fibrosis consistent with myelofibrosis.
See also OMIM:617441
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078570108 – 241Missing in THAMY; increased protein degradation; decreased enhancement of hematopoietic lineage differentiation. 1 PublicationAdd BLAST134

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi211Y → F: Abolishes the inhibitory effect against ligand-induced activation of PLCG2 by CLEC1B and GP6:FCER1G; when associated with F-237. 1 Publication1
Mutagenesisi211Y → F: Loss of tyrosine phosphorylation and loss of interaction with PTPN6 and PTPN11. 1 Publication1
Mutagenesisi237Y → F: Abolishes the inhibitory effect against ligand-induced activation of PLCG2 by CLEC1B and GP6:FCER1G; when associated with F-237. 1 Publication1
Mutagenesisi237Y → F: Reduced level of tyrosine phosphorylation and interaction with PTPN6 and PTPN11. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
80739

MalaCards human disease database

More...
MalaCardsi
MPIG6B
MIMi617441 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000204420

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25926

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MPIG6B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 171 PublicationAdd BLAST17
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002131218 – 241Megakaryocyte and platelet inhibitory receptor G6bAdd BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi32N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei211Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

All isoforms are N-glycosylated.2 Publications
Isoform E is O-glycosylated.1 Publication
Phosphorylated.2 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95866

PeptideAtlas

More...
PeptideAtlasi
O95866

PRoteomics IDEntifications database

More...
PRIDEi
O95866

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51101
51102 [O95866-2]
51103 [O95866-3]
51104 [O95866-4]
51105 [O95866-5]
51106 [O95866-6]
51107 [O95866-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95866

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95866

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in platelets. Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell line Raji, the fibroblast cell lines TK and HeLa, or the natural killer cell lines NKL, NK 62 and YT.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204420 Expressed in 80 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95866 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95866 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA073017

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via ITIM motif) with PTPN6 and PTPN11 (PubMed:11544253, PubMed:23112346). Binds to heparin (PubMed:15848171).1 Publication3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123283, 2 interactors

Protein interaction database and analysis system

More...
IntActi
O95866, 3 interactors

Molecular INTeraction database

More...
MINTi
O95866

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364964

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95866

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95866

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi209 – 214ITIM motif1 Publication6
Motifi235 – 240ITIM motif1 Publication6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Isoform B, displayed in this entry, is the only one of the isoforms to contain both a transmembrane region and 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. The 2 ITIM motifs of isoform B are required for the inhibition of CLEC1B and GP6:FCER1G signaling and platelet activation.1 Publication

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IYA7 Eukaryota
ENOG41118MY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017793

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080566

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95866

Identification of Orthologs from Complete Genome Data

More...
OMAi
PRFPACK

Database of Orthologous Groups

More...
OrthoDBi
1615599at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95866

TreeFam database of animal gene trees

More...
TreeFami
TF337394

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028070 G6B

The PANTHER Classification System

More...
PANTHERi
PTHR37347 PTHR37347, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15096 G6B, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform B1 Publication (identifier: O95866-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVFLQLLPL LLSRAQGNPG ASLDGRPGDR VNLSCGGVSH PIRWVWAPSF
60 70 80 90 100
PACKGLSKGR RPILWASSSG TPTVPPLQPF VGRLRSLDSG IRRLELLLSA
110 120 130 140 150
GDSGTFFCKG RHEDESRTVL HVLGDRTYCK APGPTHGSVY PQLLIPLLGA
160 170 180 190 200
GLVLGLGALG LVWWLHRRLP PQPIRPLPRF APLVKTEPQR PVKEEEPKIP
210 220 230 240
GDLDQEPSLL YADLDHLALS RPRRLSTADP ADASTIYAVV V
Length:241
Mass (Da):26,163
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC1390699EAA109BD
GO
Isoform A1 Publication (identifier: O95866-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...APPAVHSGPC

Show »
Length:237
Mass (Da):25,003
Checksum:i109526EF36D3B6CF
GO
Isoform C1 Publication (identifier: O95866-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-180: SVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRF → ACPRNRFDHSLDLLCPPHI

Show »
Length:217
Mass (Da):23,573
Checksum:i826F70FE5B45B9A0
GO
Isoform D1 Publication (identifier: O95866-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-241: GSVYPQLLIP...DASTIYAVVV → ALSPPHSSTC...APPAVHSGPC

Show »
Length:193
Mass (Da):20,169
Checksum:iE490E4D05BAF1652
GO
Isoform E1 Publication (identifier: O95866-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-180: Missing.

Show »
Length:197
Mass (Da):21,329
Checksum:i9183A850EEA4CB82
GO
Isoform F1 Publication (identifier: O95866-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-241: APLVKTEPQR...DASTIYAVVV → GETNSTPFSF...SPSFSSVPPT

Show »
Length:225
Mass (Da):24,225
Checksum:i1C0BF72C6E0D7CE2
GO
Isoform G1 Publication (identifier: O95866-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-241: PLVKTEPQRP...DASTIYAVVV → LSPPHSSTCE...TGKGMGMGRG

Show »
Length:222
Mass (Da):23,578
Checksum:i6253F93B2D56D1A6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7ZLJ5B7ZLJ5_HUMAN
C6orf25 protein
MPIG6B C6orf25
220Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JJG8A0A0G2JJG8_HUMAN
Megakaryocyte and platelet inhibito...
MPIG6B
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9L8A0A140T9L8_HUMAN
C6orf25
MPIG6B
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDG3F8WDG3_HUMAN
Megakaryocyte and platelet inhibito...
MPIG6B
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9V1A0A140T9V1_HUMAN
Megakaryocyte and platelet inhibito...
MPIG6B
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti137 – 138GS → ID in CAI18409 (PubMed:14574404).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_078570108 – 241Missing in THAMY; increased protein degradation; decreased enhancement of hematopoietic lineage differentiation. 1 PublicationAdd BLAST134
Natural variantiVAR_051004175R → G1 PublicationCorresponds to variant dbSNP:rs11575845Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_014172137 – 241GSVYP…YAVVV → ALSPPHSSTCENRAPEASKG GRAQDSRGPGPGTEPALCGS GPSSPQQAPPAVHSGPC in isoform D. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_014173137 – 180Missing in isoform E. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_014174138 – 180SVYPQ…PLPRF → ACPRNRFDHSLDLLCPPHI in isoform C. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_014175181 – 241APLVK…YAVVV → GETNSTPFSFSYMPTPHPSI PESEPLLGADTLVTFSPSFS SVPPT in isoform F. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_014176182 – 241PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTEPALCGSG PSSPQQAPPAVHSGPC in isoform A. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_014177182 – 241PLVKT…YAVVV → LSPPHSSTCENRAPEASKGG RAQDSRGPGPGTGKGMGMGR G in isoform G. 2 PublicationsAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ292259 mRNA Translation: CAC83497.1
AJ292260 mRNA Translation: CAC83496.1
AJ292261 mRNA Translation: CAC83498.1
AJ292262 mRNA Translation: CAC83502.1
AJ292263 mRNA Translation: CAC83499.1
AJ292264 mRNA Translation: CAC83500.1
AJ292265 mRNA Translation: CAC83501.1
AF129756 Genomic DNA Translation: AAD18075.1
BA000025 Genomic DNA Translation: BAB63378.1
AL670886 Genomic DNA Translation: CAI17813.2
AL670886 Genomic DNA Translation: CAI17814.2
AL670886 Genomic DNA Translation: CAI17815.1
AL670886 Genomic DNA Translation: CAI17816.2
AL670886 Genomic DNA Translation: CAI17818.2
AL662899 Genomic DNA Translation: CAI18406.2
AL662899 Genomic DNA Translation: CAI18407.2
AL662899 Genomic DNA Translation: CAI18408.1
AL662899 Genomic DNA Translation: CAI18409.2
AL662899 Genomic DNA Translation: CAI18412.2
BX248244 Genomic DNA Translation: CAM26092.1
BX248244 Genomic DNA Translation: CAM26093.1
BX248244 Genomic DNA Translation: CAM26094.1
BX248244 Genomic DNA Translation: CAM26095.1
BX248244 Genomic DNA Translation: CAM26096.1
AL844216 Genomic DNA Translation: CAM45767.1
AL844216 Genomic DNA Translation: CAM45768.1
AL844216 Genomic DNA Translation: CAM45769.1
AL844216 Genomic DNA Translation: CAM45770.1
AL844216 Genomic DNA Translation: CAM45771.1
CR354443 Genomic DNA Translation: CAQ07017.1
CR354443 Genomic DNA Translation: CAQ07020.1
CR354443 Genomic DNA Translation: CAQ07021.1
CR936239 Genomic DNA Translation: CAQ08890.1
CR936239 Genomic DNA Translation: CAQ08892.1
CR936239 Genomic DNA Translation: CAQ08893.1
CR936239 Genomic DNA Translation: CAQ08894.1
CR759787 Genomic DNA Translation: CAQ10105.1
CR759787 Genomic DNA Translation: CAQ10107.1
CR759787 Genomic DNA Translation: CAQ10108.1
CR759787 Genomic DNA Translation: CAQ10109.1
CH471081 Genomic DNA Translation: EAX03493.1
CH471081 Genomic DNA Translation: EAX03494.1
CH471081 Genomic DNA Translation: EAX03497.1
CH471081 Genomic DNA Translation: EAX03498.1
BC113719 mRNA Translation: AAI13720.1
BC113721 mRNA Translation: AAI13722.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34405.1 [O95866-5]
CCDS34406.1 [O95866-2]
CCDS34407.1 [O95866-7]
CCDS4715.1 [O95866-1]
CCDS4716.1 [O95866-3]
CCDS4717.1 [O95866-4]

NCBI Reference Sequences

More...
RefSeqi
NP_079536.2, NM_025260.3 [O95866-2]
NP_612116.1, NM_138272.2 [O95866-1]
NP_612117.1, NM_138273.2 [O95866-3]
NP_612118.1, NM_138274.2 [O95866-4]
NP_612119.1, NM_138275.2 [O95866-5]
NP_612121.1, NM_138277.2 [O95866-7]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.247879

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375804; ENSP00000364962; ENSG00000204420 [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420 [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420 [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420 [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420 [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420 [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396 [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396 [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396 [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396 [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396 [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090 [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393 [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459 [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060 [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060 [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393 [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060 [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003 [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060 [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090 [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003 [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003 [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003 [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459 [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459 [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393 [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459 [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003 [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393 [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393 [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459 [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060 [O95866-1]
ENST00000649779; ENSP00000497720; ENSG00000204420 [O95866-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80739

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80739

UCSC genome browser

More...
UCSCi
uc003nwk.4 human [O95866-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ292259 mRNA Translation: CAC83497.1
AJ292260 mRNA Translation: CAC83496.1
AJ292261 mRNA Translation: CAC83498.1
AJ292262 mRNA Translation: CAC83502.1
AJ292263 mRNA Translation: CAC83499.1
AJ292264 mRNA Translation: CAC83500.1
AJ292265 mRNA Translation: CAC83501.1
AF129756 Genomic DNA Translation: AAD18075.1
BA000025 Genomic DNA Translation: BAB63378.1
AL670886 Genomic DNA Translation: CAI17813.2
AL670886 Genomic DNA Translation: CAI17814.2
AL670886 Genomic DNA Translation: CAI17815.1
AL670886 Genomic DNA Translation: CAI17816.2
AL670886 Genomic DNA Translation: CAI17818.2
AL662899 Genomic DNA Translation: CAI18406.2
AL662899 Genomic DNA Translation: CAI18407.2
AL662899 Genomic DNA Translation: CAI18408.1
AL662899 Genomic DNA Translation: CAI18409.2
AL662899 Genomic DNA Translation: CAI18412.2
BX248244 Genomic DNA Translation: CAM26092.1
BX248244 Genomic DNA Translation: CAM26093.1
BX248244 Genomic DNA Translation: CAM26094.1
BX248244 Genomic DNA Translation: CAM26095.1
BX248244 Genomic DNA Translation: CAM26096.1
AL844216 Genomic DNA Translation: CAM45767.1
AL844216 Genomic DNA Translation: CAM45768.1
AL844216 Genomic DNA Translation: CAM45769.1
AL844216 Genomic DNA Translation: CAM45770.1
AL844216 Genomic DNA Translation: CAM45771.1
CR354443 Genomic DNA Translation: CAQ07017.1
CR354443 Genomic DNA Translation: CAQ07020.1
CR354443 Genomic DNA Translation: CAQ07021.1
CR936239 Genomic DNA Translation: CAQ08890.1
CR936239 Genomic DNA Translation: CAQ08892.1
CR936239 Genomic DNA Translation: CAQ08893.1
CR936239 Genomic DNA Translation: CAQ08894.1
CR759787 Genomic DNA Translation: CAQ10105.1
CR759787 Genomic DNA Translation: CAQ10107.1
CR759787 Genomic DNA Translation: CAQ10108.1
CR759787 Genomic DNA Translation: CAQ10109.1
CH471081 Genomic DNA Translation: EAX03493.1
CH471081 Genomic DNA Translation: EAX03494.1
CH471081 Genomic DNA Translation: EAX03497.1
CH471081 Genomic DNA Translation: EAX03498.1
BC113719 mRNA Translation: AAI13720.1
BC113721 mRNA Translation: AAI13722.1
CCDSiCCDS34405.1 [O95866-5]
CCDS34406.1 [O95866-2]
CCDS34407.1 [O95866-7]
CCDS4715.1 [O95866-1]
CCDS4716.1 [O95866-3]
CCDS4717.1 [O95866-4]
RefSeqiNP_079536.2, NM_025260.3 [O95866-2]
NP_612116.1, NM_138272.2 [O95866-1]
NP_612117.1, NM_138273.2 [O95866-3]
NP_612118.1, NM_138274.2 [O95866-4]
NP_612119.1, NM_138275.2 [O95866-5]
NP_612121.1, NM_138277.2 [O95866-7]
UniGeneiHs.247879

3D structure databases

ProteinModelPortaliO95866
SMRiO95866
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123283, 2 interactors
IntActiO95866, 3 interactors
MINTiO95866
STRINGi9606.ENSP00000364964

PTM databases

iPTMnetiO95866
PhosphoSitePlusiO95866

Polymorphism and mutation databases

BioMutaiMPIG6B

Proteomic databases

PaxDbiO95866
PeptideAtlasiO95866
PRIDEiO95866
ProteomicsDBi51101
51102 [O95866-2]
51103 [O95866-3]
51104 [O95866-4]
51105 [O95866-5]
51106 [O95866-6]
51107 [O95866-7]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
80739
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375804; ENSP00000364962; ENSG00000204420 [O95866-4]
ENST00000375805; ENSP00000364963; ENSG00000204420 [O95866-3]
ENST00000375806; ENSP00000364964; ENSG00000204420 [O95866-1]
ENST00000375809; ENSP00000364967; ENSG00000204420 [O95866-2]
ENST00000375810; ENSP00000364968; ENSG00000204420 [O95866-7]
ENST00000375814; ENSP00000364972; ENSG00000204420 [O95866-5]
ENST00000383410; ENSP00000372902; ENSG00000206396 [O95866-5]
ENST00000383411; ENSP00000372903; ENSG00000206396 [O95866-3]
ENST00000383412; ENSP00000372904; ENSG00000206396 [O95866-2]
ENST00000400067; ENSP00000382940; ENSG00000206396 [O95866-4]
ENST00000400071; ENSP00000382944; ENSG00000206396 [O95866-1]
ENST00000411608; ENSP00000392961; ENSG00000228090 [O95866-4]
ENST00000415728; ENSP00000408430; ENSG00000224393 [O95866-1]
ENST00000415984; ENSP00000394082; ENSG00000237459 [O95866-5]
ENST00000417610; ENSP00000412747; ENSG00000230060 [O95866-4]
ENST00000422012; ENSP00000398061; ENSG00000230060 [O95866-3]
ENST00000425998; ENSP00000392917; ENSG00000224393 [O95866-4]
ENST00000426729; ENSP00000390272; ENSG00000230060 [O95866-2]
ENST00000428302; ENSP00000404519; ENSG00000231003 [O95866-2]
ENST00000431888; ENSP00000390821; ENSG00000230060 [O95866-5]
ENST00000433769; ENSP00000413647; ENSG00000228090 [O95866-5]
ENST00000435007; ENSP00000401892; ENSG00000231003 [O95866-3]
ENST00000436030; ENSP00000406706; ENSG00000231003 [O95866-1]
ENST00000437153; ENSP00000412937; ENSG00000231003 [O95866-4]
ENST00000440063; ENSP00000388982; ENSG00000237459 [O95866-4]
ENST00000444404; ENSP00000415282; ENSG00000237459 [O95866-2]
ENST00000445381; ENSP00000396823; ENSG00000224393 [O95866-3]
ENST00000447587; ENSP00000416447; ENSG00000237459 [O95866-1]
ENST00000449633; ENSP00000388484; ENSG00000231003 [O95866-5]
ENST00000451549; ENSP00000395801; ENSG00000224393 [O95866-2]
ENST00000455185; ENSP00000414824; ENSG00000224393 [O95866-5]
ENST00000457450; ENSP00000395279; ENSG00000237459 [O95866-3]
ENST00000457884; ENSP00000391097; ENSG00000230060 [O95866-1]
ENST00000649779; ENSP00000497720; ENSG00000204420 [O95866-1]
GeneIDi80739
KEGGihsa:80739
UCSCiuc003nwk.4 human [O95866-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80739
DisGeNETi80739
EuPathDBiHostDB:ENSG00000204420.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MPIG6B
HGNCiHGNC:13937 MPIG6B
HPAiHPA073017
MalaCardsiMPIG6B
MIMi606520 gene
617441 phenotype
neXtProtiNX_O95866
OpenTargetsiENSG00000204420
PharmGKBiPA25926

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IYA7 Eukaryota
ENOG41118MY LUCA
GeneTreeiENSGT00390000017793
HOVERGENiHBG080566
InParanoidiO95866
OMAiPRFPACK
OrthoDBi1615599at2759
PhylomeDBiO95866
TreeFamiTF337394

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
G6B_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80739

Protein Ontology

More...
PROi
PR:O95866

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204420 Expressed in 80 organ(s), highest expression level in leukocyte
ExpressionAtlasiO95866 baseline and differential
GenevisibleiO95866 HS

Family and domain databases

InterProiView protein in InterPro
IPR028070 G6B
PANTHERiPTHR37347 PTHR37347, 1 hit
PfamiView protein in Pfam
PF15096 G6B, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiG6B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95866
Secondary accession number(s): A2BEZ1
, A2BEZ2, A2BEZ3, A2BEZ4, A2BEZ5, B0UXC4, B0UXC7, B0UXC8, B0V024, B0V026, Q14CK2, Q96A86, Q96A87, Q96A88, Q96A89, Q96A90, Q96A91
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: May 1, 1999
Last modified: January 16, 2019
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again