Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

3'(2'),5'-bisphosphate nucleotidase 1

Gene

BPNT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins1P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi74Magnesium 11
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei74SubstrateBy similarity1
Metal bindingi117Magnesium 11
Metal bindingi117Magnesium 21
Metal bindingi119Magnesium 1; via carbonyl oxygen1
Metal bindingi120Magnesium 21
Metal bindingi247Magnesium 21
Binding sitei247Substrate1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 3'(2'),5'-bisphosphate nucleotidase activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandLithium, Magnesium, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.7 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156584 Cytosolic sulfonation of small molecules

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
3'(2'),5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Alternative name(s):
Bisphosphate 3'-nucleotidase 1
PAP-inositol 1,4-phosphatase
Short name:
PIP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BPNT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000162813.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1096 BPNT1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604053 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95861

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10380

Open Targets

More...
OpenTargetsi
ENSG00000162813

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25407

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001425272 – 3083'(2'),5'-bisphosphate nucleotidase 1Add BLAST307

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei122PhosphothreonineCombined sources1
Modified residuei240PhosphoserineCombined sources1
Modified residuei244N6-succinyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95861

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95861

PeptideAtlas

More...
PeptideAtlasi
O95861

PRoteomics IDEntifications database

More...
PRIDEi
O95861

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51094
51095 [O95861-2]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00410214

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
O95861

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95861

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95861

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162813 Expressed in 186 organ(s), highest expression level in mucosa of transverse colon

CleanEx database of gene expression profiles

More...
CleanExi
HS_BPNT1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95861 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95861 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048461

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115653, 63 interactors

Protein interaction database and analysis system

More...
IntActi
O95861, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318852

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1308
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95861

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95861

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O95861

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni119 – 122Substrate binding4
Regioni195 – 198Substrate binding4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3099 Eukaryota
ENOG410XNMV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157359

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000293205

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050719

KEGG Orthology (KO)

More...
KOi
K01082

Identification of Orthologs from Complete Genome Data

More...
OMAi
IHQPFYK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0CFP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95861

TreeFam database of animal gene trees

More...
TreeFami
TF314300

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020583 Inositol_monoP_metal-BS
IPR000760 Inositol_monophosphatase-like
IPR020550 Inositol_monophosphatase_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00459 Inositol_P, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00629 IMP_1, 1 hit
PS00630 IMP_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95861-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSNTVLMR LVASAYSIAQ KAGMIVRRVI AEGDLGIVEK TCATDLQTKA
60 70 80 90 100
DRLAQMSICS SLARKFPKLT IIGEEDLPSE EVDQELIEDS QWEEILKQPC
110 120 130 140 150
PSQYSAIKEE DLVVWVDPLD GTKEYTEGLL DNVTVLIGIA YEGKAIAGVI
160 170 180 190 200
NQPYYNYEAG PDAVLGRTIW GVLGLGAFGF QLKEVPAGKH IITTTRSHSN
210 220 230 240 250
KLVTDCVAAM NPDAVLRVGG AGNKIIQLIE GKASAYVFAS PGCKKWDTCA
260 270 280 290 300
PEVILHAVGG KLTDIHGNVL QYHKDVKHMN SAGVLATLRN YDYYASRVPE

SIKNALVP
Length:308
Mass (Da):33,392
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA5952F5E31C8CFCB
GO
Isoform 2 (identifier: O95861-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     277-308: KHMNSAGVLATLRNYDYYASRVPESIKNALVP → SHRTWPKPDF...VIIYAYETDL

Note: No experimental confirmation available.
Show »
Length:325
Mass (Da):35,744
Checksum:i87527CD609009E68
GO
Isoform 3 (identifier: O95861-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:253
Mass (Da):27,543
Checksum:i6253BEF5F96A25E1
GO
Isoform 4 (identifier: O95861-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-111: Missing.

Show »
Length:272
Mass (Da):29,189
Checksum:iFC6456F98BDED5AC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NF51A6NF51_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VRY7F8VRY7_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZG4F8VZG4_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1J0F8W1J0_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVW8F8VVW8_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti221A → V in AAH17801 (PubMed:15489334).Curated1
Sequence conflicti260G → S in CAB65115 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0548071 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_05480876 – 111Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_009937277 – 308KHMNS…NALVP → SHRTWPKPDFFRAQFFLESH SCFSRNFKNVSTPIKNIYDV IIYAYETDL in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF125042 mRNA Translation: AAD17329.1
AJ249339 mRNA Translation: CAB65115.1
AK291943 mRNA Translation: BAF84632.1
AK298476 mRNA Translation: BAG60687.1
AK300777 mRNA Translation: BAG62441.1
AC103590 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93306.1
CH471100 Genomic DNA Translation: EAW93308.1
BC017801 mRNA Translation: AAH17801.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41469.1 [O95861-1]
CCDS65787.1 [O95861-3]
CCDS65788.1 [O95861-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001273078.1, NM_001286149.1 [O95861-3]
NP_001273079.1, NM_001286150.1 [O95861-4]
NP_001273080.1, NM_001286151.1 [O95861-3]
NP_006076.4, NM_006085.5 [O95861-1]
XP_005273057.1, XM_005273000.4 [O95861-1]
XP_016855532.1, XM_017000043.1 [O95861-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.406134

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000322067; ENSP00000318852; ENSG00000162813 [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813 [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813 [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813 [O95861-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10380

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10380

UCSC genome browser

More...
UCSCi
uc010puh.3 human [O95861-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF125042 mRNA Translation: AAD17329.1
AJ249339 mRNA Translation: CAB65115.1
AK291943 mRNA Translation: BAF84632.1
AK298476 mRNA Translation: BAG60687.1
AK300777 mRNA Translation: BAG62441.1
AC103590 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93306.1
CH471100 Genomic DNA Translation: EAW93308.1
BC017801 mRNA Translation: AAH17801.1
CCDSiCCDS41469.1 [O95861-1]
CCDS65787.1 [O95861-3]
CCDS65788.1 [O95861-4]
RefSeqiNP_001273078.1, NM_001286149.1 [O95861-3]
NP_001273079.1, NM_001286150.1 [O95861-4]
NP_001273080.1, NM_001286151.1 [O95861-3]
NP_006076.4, NM_006085.5 [O95861-1]
XP_005273057.1, XM_005273000.4 [O95861-1]
XP_016855532.1, XM_017000043.1 [O95861-4]
UniGeneiHs.406134

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WEFX-ray1.80A6-308[»]
ProteinModelPortaliO95861
SMRiO95861
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115653, 63 interactors
IntActiO95861, 3 interactors
STRINGi9606.ENSP00000318852

PTM databases

DEPODiO95861
iPTMnetiO95861
PhosphoSitePlusiO95861

2D gel databases

REPRODUCTION-2DPAGEiIPI00410214

Proteomic databases

EPDiO95861
PaxDbiO95861
PeptideAtlasiO95861
PRIDEiO95861
ProteomicsDBi51094
51095 [O95861-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322067; ENSP00000318852; ENSG00000162813 [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813 [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813 [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813 [O95861-3]
GeneIDi10380
KEGGihsa:10380
UCSCiuc010puh.3 human [O95861-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10380
DisGeNETi10380
EuPathDBiHostDB:ENSG00000162813.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BPNT1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0001601
HGNCiHGNC:1096 BPNT1
HPAiHPA048461
MIMi604053 gene
neXtProtiNX_O95861
OpenTargetsiENSG00000162813
PharmGKBiPA25407

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3099 Eukaryota
ENOG410XNMV LUCA
GeneTreeiENSGT00940000157359
HOGENOMiHOG000293205
HOVERGENiHBG050719
KOiK01082
OMAiIHQPFYK
OrthoDBiEOG091G0CFP
PhylomeDBiO95861
TreeFamiTF314300

Enzyme and pathway databases

BRENDAi3.1.3.7 2681
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Miscellaneous databases

EvolutionaryTraceiO95861

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10380

Protein Ontology

More...
PROi
PR:O95861

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162813 Expressed in 186 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_BPNT1
ExpressionAtlasiO95861 baseline and differential
GenevisibleiO95861 HS

Family and domain databases

InterProiView protein in InterPro
IPR020583 Inositol_monoP_metal-BS
IPR000760 Inositol_monophosphatase-like
IPR020550 Inositol_monophosphatase_CS
PfamiView protein in Pfam
PF00459 Inositol_P, 1 hit
PROSITEiView protein in PROSITE
PS00629 IMP_1, 1 hit
PS00630 IMP_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBPNT1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95861
Secondary accession number(s): A8K7C8
, B4DPS5, B4DUS9, D3DTA9, Q8WVL5, Q9UGJ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: May 1, 1999
Last modified: December 5, 2018
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again