Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

3'(2'),5'-bisphosphate nucleotidase 1

Gene

BPNT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins1P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.1 Publication

Catalytic activityi

Adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate.

Cofactori

Activity regulationi

Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4-bisphosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi74Magnesium 11
Binding sitei74SubstrateBy similarity1
Metal bindingi117Magnesium 11
Metal bindingi117Magnesium 21
Metal bindingi119Magnesium 1; via carbonyl oxygen1
Metal bindingi120Magnesium 21
Metal bindingi247Magnesium 21
Binding sitei247Substrate1

GO - Molecular functioni

  • 3'(2'),5'-bisphosphate nucleotidase activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandLithium, Magnesium, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.3.7 2681
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Names & Taxonomyi

Protein namesi
Recommended name:
3'(2'),5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Alternative name(s):
Bisphosphate 3'-nucleotidase 1
PAP-inositol 1,4-phosphatase
Short name:
PIP
Gene namesi
Name:BPNT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162813.17
HGNCiHGNC:1096 BPNT1
MIMi604053 gene
neXtProtiNX_O95861

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi10380
OpenTargetsiENSG00000162813
PharmGKBiPA25407

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001425272 – 3083'(2'),5'-bisphosphate nucleotidase 1Add BLAST307

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei122PhosphothreonineCombined sources1
Modified residuei240PhosphoserineCombined sources1
Modified residuei244N6-succinyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO95861
PaxDbiO95861
PeptideAtlasiO95861
PRIDEiO95861
ProteomicsDBi51094
51095 [O95861-2]

2D gel databases

REPRODUCTION-2DPAGEiIPI00410214

PTM databases

DEPODiO95861
iPTMnetiO95861
PhosphoSitePlusiO95861

Expressioni

Tissue specificityi

Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000162813 Expressed in 186 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_BPNT1
ExpressionAtlasiO95861 baseline and differential
GenevisibleiO95861 HS

Organism-specific databases

HPAiHPA048461

Interactioni

Protein-protein interaction databases

BioGridi115653, 63 interactors
IntActiO95861, 3 interactors
STRINGi9606.ENSP00000318852

Structurei

Secondary structure

1308
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO95861
SMRiO95861
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95861

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni119 – 122Substrate binding4
Regioni195 – 198Substrate binding4

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3099 Eukaryota
ENOG410XNMV LUCA
GeneTreeiENSGT00930000150932
HOGENOMiHOG000293205
HOVERGENiHBG050719
KOiK01082
OMAiIHQPFYK
OrthoDBiEOG091G0CFP
PhylomeDBiO95861
TreeFamiTF314300

Family and domain databases

InterProiView protein in InterPro
IPR020583 Inositol_monoP_metal-BS
IPR000760 Inositol_monophosphatase-like
IPR020550 Inositol_monophosphatase_CS
PfamiView protein in Pfam
PF00459 Inositol_P, 1 hit
PROSITEiView protein in PROSITE
PS00629 IMP_1, 1 hit
PS00630 IMP_2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95861-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSNTVLMR LVASAYSIAQ KAGMIVRRVI AEGDLGIVEK TCATDLQTKA
60 70 80 90 100
DRLAQMSICS SLARKFPKLT IIGEEDLPSE EVDQELIEDS QWEEILKQPC
110 120 130 140 150
PSQYSAIKEE DLVVWVDPLD GTKEYTEGLL DNVTVLIGIA YEGKAIAGVI
160 170 180 190 200
NQPYYNYEAG PDAVLGRTIW GVLGLGAFGF QLKEVPAGKH IITTTRSHSN
210 220 230 240 250
KLVTDCVAAM NPDAVLRVGG AGNKIIQLIE GKASAYVFAS PGCKKWDTCA
260 270 280 290 300
PEVILHAVGG KLTDIHGNVL QYHKDVKHMN SAGVLATLRN YDYYASRVPE

SIKNALVP
Length:308
Mass (Da):33,392
Last modified:May 1, 1999 - v1
Checksum:iA5952F5E31C8CFCB
GO
Isoform 2 (identifier: O95861-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     277-308: KHMNSAGVLATLRNYDYYASRVPESIKNALVP → SHRTWPKPDF...VIIYAYETDL

Note: No experimental confirmation available.
Show »
Length:325
Mass (Da):35,744
Checksum:i87527CD609009E68
GO
Isoform 3 (identifier: O95861-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:253
Mass (Da):27,543
Checksum:i6253BEF5F96A25E1
GO
Isoform 4 (identifier: O95861-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-111: Missing.

Show »
Length:272
Mass (Da):29,189
Checksum:iFC6456F98BDED5AC
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A6NF51A6NF51_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
291Annotation score:
F8VRY7F8VRY7_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
116Annotation score:
F8VVW8F8VVW8_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
130Annotation score:
F8VZG4F8VZG4_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
136Annotation score:
F8W1J0F8W1J0_HUMAN
3'(2'),5'-bisphosphate nucleotidase...
BPNT1
170Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti221A → V in AAH17801 (PubMed:15489334).Curated1
Sequence conflicti260G → S in CAB65115 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548071 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_05480876 – 111Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_009937277 – 308KHMNS…NALVP → SHRTWPKPDFFRAQFFLESH SCFSRNFKNVSTPIKNIYDV IIYAYETDL in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF125042 mRNA Translation: AAD17329.1
AJ249339 mRNA Translation: CAB65115.1
AK291943 mRNA Translation: BAF84632.1
AK298476 mRNA Translation: BAG60687.1
AK300777 mRNA Translation: BAG62441.1
AC103590 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93306.1
CH471100 Genomic DNA Translation: EAW93308.1
BC017801 mRNA Translation: AAH17801.1
CCDSiCCDS41469.1 [O95861-1]
CCDS65787.1 [O95861-3]
CCDS65788.1 [O95861-4]
RefSeqiNP_001273078.1, NM_001286149.1 [O95861-3]
NP_001273079.1, NM_001286150.1 [O95861-4]
NP_001273080.1, NM_001286151.1 [O95861-3]
NP_006076.4, NM_006085.5 [O95861-1]
XP_005273057.1, XM_005273000.4 [O95861-1]
XP_016855532.1, XM_017000043.1 [O95861-4]
UniGeneiHs.406134

Genome annotation databases

EnsembliENST00000322067; ENSP00000318852; ENSG00000162813 [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813 [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813 [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813 [O95861-3]
GeneIDi10380
KEGGihsa:10380
UCSCiuc010puh.3 human [O95861-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF125042 mRNA Translation: AAD17329.1
AJ249339 mRNA Translation: CAB65115.1
AK291943 mRNA Translation: BAF84632.1
AK298476 mRNA Translation: BAG60687.1
AK300777 mRNA Translation: BAG62441.1
AC103590 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93306.1
CH471100 Genomic DNA Translation: EAW93308.1
BC017801 mRNA Translation: AAH17801.1
CCDSiCCDS41469.1 [O95861-1]
CCDS65787.1 [O95861-3]
CCDS65788.1 [O95861-4]
RefSeqiNP_001273078.1, NM_001286149.1 [O95861-3]
NP_001273079.1, NM_001286150.1 [O95861-4]
NP_001273080.1, NM_001286151.1 [O95861-3]
NP_006076.4, NM_006085.5 [O95861-1]
XP_005273057.1, XM_005273000.4 [O95861-1]
XP_016855532.1, XM_017000043.1 [O95861-4]
UniGeneiHs.406134

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WEFX-ray1.80A6-308[»]
ProteinModelPortaliO95861
SMRiO95861
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115653, 63 interactors
IntActiO95861, 3 interactors
STRINGi9606.ENSP00000318852

PTM databases

DEPODiO95861
iPTMnetiO95861
PhosphoSitePlusiO95861

2D gel databases

REPRODUCTION-2DPAGEiIPI00410214

Proteomic databases

EPDiO95861
PaxDbiO95861
PeptideAtlasiO95861
PRIDEiO95861
ProteomicsDBi51094
51095 [O95861-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322067; ENSP00000318852; ENSG00000162813 [O95861-1]
ENST00000414869; ENSP00000410348; ENSG00000162813 [O95861-4]
ENST00000469520; ENSP00000446828; ENSG00000162813 [O95861-1]
ENST00000544404; ENSP00000444398; ENSG00000162813 [O95861-3]
GeneIDi10380
KEGGihsa:10380
UCSCiuc010puh.3 human [O95861-1]

Organism-specific databases

CTDi10380
DisGeNETi10380
EuPathDBiHostDB:ENSG00000162813.17
GeneCardsiBPNT1
H-InvDBiHIX0001601
HGNCiHGNC:1096 BPNT1
HPAiHPA048461
MIMi604053 gene
neXtProtiNX_O95861
OpenTargetsiENSG00000162813
PharmGKBiPA25407
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3099 Eukaryota
ENOG410XNMV LUCA
GeneTreeiENSGT00930000150932
HOGENOMiHOG000293205
HOVERGENiHBG050719
KOiK01082
OMAiIHQPFYK
OrthoDBiEOG091G0CFP
PhylomeDBiO95861
TreeFamiTF314300

Enzyme and pathway databases

BRENDAi3.1.3.7 2681
ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Miscellaneous databases

EvolutionaryTraceiO95861
GenomeRNAii10380
PROiPR:O95861
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162813 Expressed in 186 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_BPNT1
ExpressionAtlasiO95861 baseline and differential
GenevisibleiO95861 HS

Family and domain databases

InterProiView protein in InterPro
IPR020583 Inositol_monoP_metal-BS
IPR000760 Inositol_monophosphatase-like
IPR020550 Inositol_monophosphatase_CS
PfamiView protein in Pfam
PF00459 Inositol_P, 1 hit
PROSITEiView protein in PROSITE
PS00629 IMP_1, 1 hit
PS00630 IMP_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBPNT1_HUMAN
AccessioniPrimary (citable) accession number: O95861
Secondary accession number(s): A8K7C8
, B4DPS5, B4DUS9, D3DTA9, Q8WVL5, Q9UGJ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 155 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again