Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitogen-activated protein kinase kinase kinase kinase 4

Gene

MAP4K4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway. Phosphorylates SMAD1 on Thr-322.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei54ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei153Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi31 – 39ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2559580 Oxidative Stress Induced Senescence

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O95819

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O95819

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mitogen-activated protein kinase kinase kinase kinase 4 (EC:2.7.11.1)
Alternative name(s):
HPK/GCK-like kinase HGK
MAPK/ERK kinase kinase kinase 4
Short name:
MEK kinase kinase 4
Short name:
MEKKK 4
Nck-interacting kinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAP4K4
Synonyms:HGK, KIAA0687, NIK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000071054.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6866 MAP4K4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604666 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95819

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9448

Open Targets

More...
OpenTargetsi
ENSG00000071054

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30612

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6166

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2088

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MAP4K4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000862802 – 1239Mitogen-activated protein kinase kinase kinase kinase 4Add BLAST1238

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei324PhosphoserineBy similarity1
Modified residuei326PhosphoserineBy similarity1
Modified residuei629PhosphoserineCombined sources1
Modified residuei631PhosphoserineCombined sources1
Modified residuei639PhosphoserineCombined sources1
Modified residuei644PhosphoserineCombined sources1
Modified residuei656PhosphoserineBy similarity1
Modified residuei700PhosphoserineCombined sources1
Modified residuei712PhosphoserineCombined sources1
Modified residuei715PhosphoserineCombined sources1
Modified residuei791PhosphoserineCombined sources1
Modified residuei800PhosphoserineCombined sources1
Modified residuei801PhosphoserineCombined sources1
Modified residuei805PhosphoserineCombined sources1
Modified residuei823PhosphoserineCombined sources1
Modified residuei828PhosphothreonineCombined sources1
Modified residuei852PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei900PhosphoserineCombined sources1
Modified residuei913PhosphoserineCombined sources1
Isoform 21 Publication (identifier: O95819-2)
Modified residuei608PhosphoserineCombined sources1
Modified residuei625PhosphoserineCombined sources1
Isoform 6 (identifier: O95819-6)
Modified residuei608PhosphoserineCombined sources1
Modified residuei625PhosphoserineCombined sources1
Isoform 31 Publication (identifier: O95819-3)
Modified residuei716PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95819

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95819

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95819

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95819

PeptideAtlas

More...
PeptideAtlasi
O95819

PRoteomics IDEntifications database

More...
PRIDEi
O95819

ProteomicsDB human proteome resource

More...
ProteomicsDBi
51066
51067 [O95819-2]
51068 [O95819-3]
51069 [O95819-4]
51070 [O95819-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95819

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95819

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Isoform 5 is abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000071054 Expressed in 229 organ(s), highest expression level in brain

CleanEx database of gene expression profiles

More...
CleanExi
HS_MAP4K4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95819 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95819 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008476

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the SH3 domain of the adapter proteins Nck (By similarity). Interacts (via its CNH regulatory domain) with ATL1 (via the N-terminal region). Interacts with RAP2A (GTP-bound form preferentially).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
GBP3Q9H0R54EBI-2511133,EBI-2798916

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114838, 51 interactors

Protein interaction database and analysis system

More...
IntActi
O95819, 23 interactors

Molecular INTeraction database

More...
MINTi
O95819

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000314363

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O95819

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11239
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OBOX-ray2.10A/B2-328[»]
4OBPX-ray2.27A/B2-328[»]
4OBQX-ray2.19A/B2-328[»]
4RVTX-ray2.40A/B1-325[»]
4U3YX-ray1.45A/B2-328[»]
4U3ZX-ray2.09A/B2-328[»]
4U40X-ray2.30A/B2-328[»]
4U41X-ray2.20A/B2-328[»]
4U42X-ray2.50A/B2-328[»]
4U43X-ray2.18A/B2-328[»]
4U44X-ray2.43A/B2-328[»]
4U45X-ray2.58A/B2-328[»]
4ZK5X-ray2.89A/B2-328[»]
4ZP5X-ray2.29A/B1-309[»]
5DI1X-ray2.90A/B1-310[»]
5J95X-ray2.50A/B2-313[»]
5W5QX-ray2.33A/B2-328[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95819

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95819

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 289Protein kinasePROSITE-ProRule annotationAdd BLAST265
Domaini926 – 1213CNHPROSITE-ProRule annotationAdd BLAST288

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni858 – 1212Mediates interaction with RAP2A1 PublicationAdd BLAST355

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0587 Eukaryota
ENOG410YBF5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155063

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290708

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG036506

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95819

KEGG Orthology (KO)

More...
KOi
K04407

Database of Orthologous Groups

More...
OrthoDBi
533537at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95819

TreeFam database of animal gene trees

More...
TreeFami
TF105138

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001180 CNH_dom
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00780 CNH, 1 hit
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00036 CNH, 1 hit
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50219 CNH, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: O95819-1) [UniParc]FASTAAdd to basket
Also known as: Tumor-associated

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANDSPAKSL VDIDLSSLRD PAGIFELVEV VGNGTYGQVY KGRHVKTGQL
60 70 80 90 100
AAIKVMDVTE DEEEEIKLEI NMLKKYSHHR NIATYYGAFI KKSPPGHDDQ
110 120 130 140 150
LWLVMEFCGA GSITDLVKNT KGNTLKEDWI AYISREILRG LAHLHIHHVI
160 170 180 190 200
HRDIKGQNVL LTENAEVKLV DFGVSAQLDR TVGRRNTFIG TPYWMAPEVI
210 220 230 240 250
ACDENPDATY DYRSDLWSCG ITAIEMAEGA PPLCDMHPMR ALFLIPRNPP
260 270 280 290 300
PRLKSKKWSK KFFSFIEGCL VKNYMQRPST EQLLKHPFIR DQPNERQVRI
310 320 330 340 350
QLKDHIDRTR KKRGEKDETE YEYSGSEEEE EEVPEQEGEP SSIVNVPGES
360 370 380 390 400
TLRRDFLRLQ QENKERSEAL RRQQLLQEQQ LREQEEYKRQ LLAERQKRIE
410 420 430 440 450
QQKEQRRRLE EQQRREREAR RQQEREQRRR EQEEKRRLEE LERRRKEEEE
460 470 480 490 500
RRRAEEEKRR VEREQEYIRR QLEEEQRHLE VLQQQLLQEQ AMLLECRWRE
510 520 530 540 550
MEEHRQAERL QRQLQQEQAY LLSLQHDHRR PHPQHSQQPP PPQQERSKPS
560 570 580 590 600
FHAPEPKAHY EPADRAREVE DRFRKTNHSS PEAQSKQTGR VLEPPVPSRS
610 620 630 640 650
ESFSNGNSES VHPALQRPAE PQVPVRTTSR SPVLSRRDSP LQGSGQQNSQ
660 670 680 690 700
AGQRNSTSIE PRLLWERVEK LVPRPGSGSS SGSSNSGSQP GSHPGSQSGS
710 720 730 740 750
GERFRVRSSS KSEGSPSQRL ENAVKKPEDK KEVFRPLKPA DLTALAKELR
760 770 780 790 800
AVEDVRPPHK VTDYSSSSEE SGTTDEEDDD VEQEGADEST SGPEDTRAAS
810 820 830 840 850
SLNLSNGETE SVKTMIVHDD VESEPAMTPS KEGTLIVRQT QSASSTLQKH
860 870 880 890 900
KSSSSFTPFI DPRLLQISPS SGTTVTSVVG FSCDGMRPEA IRQDPTRKGS
910 920 930 940 950
VVNVNPTNTR PQSDTPEIRK YKKRFNSEIL CAALWGVNLL VGTESGLMLL
960 970 980 990 1000
DRSGQGKVYP LINRRRFQQM DVLEGLNVLV TISGKKDKLR VYYLSWLRNK
1010 1020 1030 1040 1050
ILHNDPEVEK KQGWTTVGDL EGCVHYKVVK YERIKFLVIA LKSSVEVYAW
1060 1070 1080 1090 1100
APKPYHKFMA FKSFGELVHK PLLVDLTVEE GQRLKVIYGS CAGFHAVDVD
1110 1120 1130 1140 1150
SGSVYDIYLP THIQCSIKPH AIIILPNTDG MELLVCYEDE GVYVNTYGRI
1160 1170 1180 1190 1200
TKDVVLQWGE MPTSVAYIRS NQTMGWGEKA IEIRSVETGH LDGVFMHKRA
1210 1220 1230
QRLKFLCERN DKVFFASVRS GGSSQVYFMT LGRTSLLSW
Length:1,239
Mass (Da):142,101
Last modified:March 28, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8FBBE2F9ABEEC757
GO
Isoform 21 Publication (identifier: O95819-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     495-525: Missing.
     659-659: I → SI
     740-740: A → AGEV

Show »
Length:1,212
Mass (Da):138,505
Checksum:i29398FB628EE847F
GO
Isoform 31 Publication (identifier: O95819-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     623-623: V → VQWSHLASLK...SDSDEVPPRV
     659-659: I → SI
     740-740: A → AGEV

Show »
Length:1,320
Mass (Da):151,000
Checksum:i17890E0DC40169EC
GO
Isoform 41 Publication (identifier: O95819-4) [UniParc]FASTAAdd to basket
Also known as: HGK-S1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     495-525: Missing.
     569-622: Missing.
     740-740: A → AGEV
     1112-1112: H → HVRKNPHSM

Show »
Length:1,165
Mass (Da):133,401
Checksum:i03D9E1A3D7F9415D
GO
Isoform 51 Publication (identifier: O95819-5) [UniParc]FASTAAdd to basket
Also known as: HGK-L1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     495-525: Missing.
     569-622: Missing.
     623-623: V → VQWSHLASLK...SDSDEVPPRV
     740-740: A → AGEV
     1112-1112: H → HVRKNPHSM

Show »
Length:1,242
Mass (Da):141,929
Checksum:iAF0219B2CA816B5B
GO
Isoform 6 (identifier: O95819-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     495-525: Missing.
     659-659: I → SI
     839-839: Q → QSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSPSSSQPTPTMSPQTPQDKLTANE

Note: Gene prediction based on EST data.Combined sources
Show »
Length:1,273
Mass (Da):145,005
Checksum:i576DCE0A50E7E776
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EN19E7EN19_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J840C9J840_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
987Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EX83E7EX83_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,038Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SEY1A0A0D9SEY1_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4 hCG_1640439
1,320Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ENQ1E7ENQ1_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C360H7C360_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E948G5E948_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SG62A0A0D9SG62_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
1,044Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3XAA2G3XAA2_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4 hCG_1640439
1,165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ETN6E7ETN6_HUMAN
Mitogen-activated protein kinase ki...
MAP4K4
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti839Q → R in AAO32626 (PubMed:12612079).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_040746712S → T1 Publication1
Isoform 31 Publication (identifier: O95819-3)
Natural varianti682D → VCombined sources1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007054495 – 525Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 2 PublicationsCuratedAdd BLAST31
Alternative sequenceiVSP_007055569 – 622Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_007056623V → VQWSHLASLKNNVSPVSRSH SFSDPSPKFAHHHLRSQDPC PPSRSEVLSQSSDSKSEAPD PTQKAWSRSDSDEVPPRV in isoform 3 and isoform 5. 2 Publications1
Alternative sequenceiVSP_058855659I → SI in isoform 2, isoform 3 and isoform 6. 2 PublicationsCurated1
Alternative sequenceiVSP_007057740A → AGEV in isoform 2, isoform 3, isoform 4 and isoform 5. 3 Publications1
Alternative sequenceiVSP_058856839Q → QSTVDQKRASHHESNGFAGR IHLLPDLLQQSHSSSTSSTS SSPSSSQPTPTMSPQTPQDK LTANE in isoform 6. Curated1
Alternative sequenceiVSP_0070581112H → HVRKNPHSM in isoform 4 and isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF096300 mRNA Translation: AAD16137.1
AY212247 mRNA Translation: AAO32626.1
AC005035 Genomic DNA No translation available.
CH471127 Genomic DNA Translation: EAX01810.1
AC007005 Genomic DNA No translation available.
AB014587 mRNA Translation: BAA31662.1
AL137755 mRNA Translation: CAB70907.2
AB013385 mRNA Translation: BAA33714.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56130.1 [O95819-1]
CCDS74546.1 [O95819-6]
CCDS82487.1 [O95819-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46481

NCBI Reference Sequences

More...
RefSeqi
NP_001229488.1, NM_001242559.1 [O95819-1]
NP_004825.3, NM_004834.4 [O95819-4]
NP_663719.2, NM_145686.3 [O95819-6]
NP_663720.1, NM_145687.3 [O95819-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.701013

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000347699; ENSP00000314363; ENSG00000071054 [O95819-1]
ENST00000350878; ENSP00000343658; ENSG00000071054 [O95819-6]
ENST00000634702; ENSP00000489579; ENSG00000071054 [O95819-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9448

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9448

UCSC genome browser

More...
UCSCi
uc002tbf.4 human
uc002tbg.4 human [O95819-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF096300 mRNA Translation: AAD16137.1
AY212247 mRNA Translation: AAO32626.1
AC005035 Genomic DNA No translation available.
CH471127 Genomic DNA Translation: EAX01810.1
AC007005 Genomic DNA No translation available.
AB014587 mRNA Translation: BAA31662.1
AL137755 mRNA Translation: CAB70907.2
AB013385 mRNA Translation: BAA33714.1
CCDSiCCDS56130.1 [O95819-1]
CCDS74546.1 [O95819-6]
CCDS82487.1 [O95819-4]
PIRiT46481
RefSeqiNP_001229488.1, NM_001242559.1 [O95819-1]
NP_004825.3, NM_004834.4 [O95819-4]
NP_663719.2, NM_145686.3 [O95819-6]
NP_663720.1, NM_145687.3 [O95819-2]
UniGeneiHs.701013

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OBOX-ray2.10A/B2-328[»]
4OBPX-ray2.27A/B2-328[»]
4OBQX-ray2.19A/B2-328[»]
4RVTX-ray2.40A/B1-325[»]
4U3YX-ray1.45A/B2-328[»]
4U3ZX-ray2.09A/B2-328[»]
4U40X-ray2.30A/B2-328[»]
4U41X-ray2.20A/B2-328[»]
4U42X-ray2.50A/B2-328[»]
4U43X-ray2.18A/B2-328[»]
4U44X-ray2.43A/B2-328[»]
4U45X-ray2.58A/B2-328[»]
4ZK5X-ray2.89A/B2-328[»]
4ZP5X-ray2.29A/B1-309[»]
5DI1X-ray2.90A/B1-310[»]
5J95X-ray2.50A/B2-313[»]
5W5QX-ray2.33A/B2-328[»]
ProteinModelPortaliO95819
SMRiO95819
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114838, 51 interactors
IntActiO95819, 23 interactors
MINTiO95819
STRINGi9606.ENSP00000314363

Chemistry databases

BindingDBiO95819
ChEMBLiCHEMBL6166
GuidetoPHARMACOLOGYi2088

PTM databases

iPTMnetiO95819
PhosphoSitePlusiO95819

Polymorphism and mutation databases

BioMutaiMAP4K4

Proteomic databases

EPDiO95819
jPOSTiO95819
MaxQBiO95819
PaxDbiO95819
PeptideAtlasiO95819
PRIDEiO95819
ProteomicsDBi51066
51067 [O95819-2]
51068 [O95819-3]
51069 [O95819-4]
51070 [O95819-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000347699; ENSP00000314363; ENSG00000071054 [O95819-1]
ENST00000350878; ENSP00000343658; ENSG00000071054 [O95819-6]
ENST00000634702; ENSP00000489579; ENSG00000071054 [O95819-4]
GeneIDi9448
KEGGihsa:9448
UCSCiuc002tbf.4 human
uc002tbg.4 human [O95819-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9448
DisGeNETi9448
EuPathDBiHostDB:ENSG00000071054.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAP4K4
HGNCiHGNC:6866 MAP4K4
HPAiHPA008476
MIMi604666 gene
neXtProtiNX_O95819
OpenTargetsiENSG00000071054
PharmGKBiPA30612

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0587 Eukaryota
ENOG410YBF5 LUCA
GeneTreeiENSGT00940000155063
HOGENOMiHOG000290708
HOVERGENiHBG036506
InParanoidiO95819
KOiK04407
OrthoDBi533537at2759
PhylomeDBiO95819
TreeFamiTF105138

Enzyme and pathway databases

ReactomeiR-HSA-2559580 Oxidative Stress Induced Senescence
SignaLinkiO95819
SIGNORiO95819

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MAP4K4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MAP4K4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9448

Protein Ontology

More...
PROi
PR:O95819

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000071054 Expressed in 229 organ(s), highest expression level in brain
CleanExiHS_MAP4K4
ExpressionAtlasiO95819 baseline and differential
GenevisibleiO95819 HS

Family and domain databases

InterProiView protein in InterPro
IPR001180 CNH_dom
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00780 CNH, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00036 CNH, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50219 CNH, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiM4K4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95819
Secondary accession number(s): E7ESS2, O75172, Q9NST7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: March 28, 2003
Last modified: January 16, 2019
This is version 188 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again