Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Copine-6

Gene

CPNE6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium-dependent phospholipid-binding protein that plays a role in calcium-mediated intracellular processes. Binds phospholipid membranes in a calcium-dependent manner (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).By similarity1 Publication

GO - Molecular functioni

  • calcium-dependent phospholipid binding Source: GO_Central
  • calcium ion binding Source: ProtInc
  • phosphatidylserine binding Source: UniProtKB
  • transporter activity Source: ProtInc

GO - Biological processi

Keywordsi

Biological processDifferentiation

Enzyme and pathway databases

ReactomeiR-HSA-1483206 Glycerophospholipid biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Copine-6Curated
Alternative name(s):
Copine VIBy similarityImported
Neuronal-copine1 Publication
Short name:
N-copine1 Publication
Gene namesi
Name:CPNE6Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000100884.9
HGNCiHGNC:2319 CPNE6
MIMi605688 gene
neXtProtiNX_O95741

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000100884
PharmGKBiPA26836

Polymorphism and mutation databases

BioMutaiCPNE6

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001448451 – 557Copine-6Add BLAST557

Proteomic databases

EPDiO95741
MaxQBiO95741
PaxDbiO95741
PeptideAtlasiO95741
PRIDEiO95741
ProteomicsDBi51017

PTM databases

iPTMnetiO95741
PhosphoSitePlusiO95741

Expressioni

Tissue specificityi

Widely expressed in the brain (PubMed:9645480, PubMed:10403379, PubMed:12949241). Expressed weakly in the kidney, liver and fetal heart (PubMed:12949241). Expressed in melanocytes (PubMed:23999003).4 Publications

Gene expression databases

BgeeiENSG00000100884 Expressed in 113 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_CPNE6
ExpressionAtlasiO95741 baseline and differential
GenevisibleiO95741 HS

Organism-specific databases

HPAiHPA031636

Interactioni

Subunit structurei

Interacts (via second C2 domain) with OS9 (via C-terminus); this interaction occurs in a calcium-dependent manner in vitro (By similarity). May interact with NECAB1 (PubMed:12044471).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MEOX2P502223EBI-719005,EBI-748397

Protein-protein interaction databases

BioGridi114763, 14 interactors
IntActiO95741, 12 interactors
MINTiO95741
STRINGi9606.ENSP00000216775

Structurei

3D structure databases

ProteinModelPortaliO95741
SMRiO95741
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 111C2 1PROSITE-ProRule annotationAdd BLAST88
Domaini138 – 243C2 2PROSITE-ProRule annotationAdd BLAST106
Domaini306 – 526VWFAPROSITE-ProRule annotationAdd BLAST221

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni244 – 303Linker regionBy similarityAdd BLAST60

Domaini

The C2 domain 1 binds phospholipids in a calcium-independent manner and is not necessary for calcium-mediated translocation and association to the plasma membrane. The C2 domain 2 binds phospholipids in a calcium-dependent manner and is necessary for calcium-mediated translocation and association to the plasma membrane. The linker region contributes to the calcium-dependent translocation and association to the plasma membrane. The VWFA domain is necessary for association with intracellular clathrin-coated vesicles in a calcium-dependent manner.By similarity

Sequence similaritiesi

Belongs to the copine family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1327 Eukaryota
ENOG410XPC8 LUCA
GeneTreeiENSGT00760000119085
HOGENOMiHOG000220898
HOVERGENiHBG066841
InParanoidiO95741
OMAiITSYRRC
OrthoDBiEOG091G05IT
PhylomeDBiO95741
TreeFamiTF316419

Family and domain databases

CDDicd04047 C2B_Copine, 1 hit
cd01459 vWA_copine_like, 1 hit
Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR037768 C2B_Copine
IPR010734 Copine
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF00168 C2, 2 hits
PF07002 Copine, 1 hit
SMARTiView protein in SMART
SM00239 C2, 2 hits
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50234 VWFA, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95741-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDPEMGWVP EPPTMTLGAS RVELRVSCHG LLDRDTLTKP HPCVLLKLYS
60 70 80 90 100
DEQWVEVERT EVLRSCSSPV FSRVLALEYF FEEKQPLQFH VFDAEDGATS
110 120 130 140 150
PRNDTFLGST ECTLGQIVSQ TKVTKPLLLK NGKTAGKSTI TIVAEEVSGT
160 170 180 190 200
NDYVQLTFRA YKLDNKDLFS KSDPFMEIYK TNEDQSDQLV WRTEVVKNNL
210 220 230 240 250
NPSWEPFRLS LHSLCSCDVH RPLKFLVYDY DSSGKHDFIG EFTSTFQEMQ
260 270 280 290 300
EGTANPGQEM QWDCINPKYR DKKKNYKSSG TVVLAQCTVE KVHTFLDYIM
310 320 330 340 350
GGCQISFTVA IDFTASNGDP RSSQSLHCLS PRQPNHYLQA LRAVGGICQD
360 370 380 390 400
YDSDKRFPAF GFGARIPPNF EVSHDFAINF DPENPECEEI SGVIASYRRC
410 420 430 440 450
LPQIQLYGPT NVAPIINRVA EPAQREQSTG QATKYSVLLV LTDGVVSDMA
460 470 480 490 500
ETRTAIVRAS RLPMSIIIVG VGNADFSDMR LLDGDDGPLR CPRGVPAARD
510 520 530 540 550
IVQFVPFRDF KDAAPSALAK CVLAEVPRQV VEYYASQGIS PGAPRPCTLA

TTPSPSP
Length:557
Mass (Da):61,991
Last modified:June 7, 2005 - v3
Checksum:iCA1ECA3560926FC2
GO
Isoform 2 (identifier: O95741-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAFKEHGKITSCCIPGPINSSRAGAGAGASGWSSKGVRARAREPERGAPDREPSDM

Show »
Length:612
Mass (Da):67,641
Checksum:i8D7C57B24D117C26
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YK44H0YK44_HUMAN
Copine-6
CPNE6
110Annotation score:
H0YLV2H0YLV2_HUMAN
Copine-6
CPNE6
226Annotation score:
H0YNM7H0YNM7_HUMAN
Copine-6
CPNE6
149Annotation score:
H0YNP2H0YNP2_HUMAN
Copine-6
CPNE6
131Annotation score:
H0YKP1H0YKP1_HUMAN
Copine-6
CPNE6
159Annotation score:
H0YNX4H0YNX4_HUMAN
Copine-6
CPNE6
141Annotation score:
H0YKJ0H0YKJ0_HUMAN
Copine-6
CPNE6
153Annotation score:
H0YM67H0YM67_HUMAN
Copine-6
CPNE6
105Annotation score:
H0YLM2H0YLM2_HUMAN
Copine-6
CPNE6
158Annotation score:
H0YNV6H0YNV6_HUMAN
Copine-6
CPNE6
65Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti13P → Q in AAH18046 (PubMed:15489334).Curated1
Sequence conflicti87L → V in AAH18046 (PubMed:15489334).Curated1
Sequence conflicti198N → S in BAH11559 (PubMed:14702039).Curated1
Sequence conflicti331P → H in BAD96395 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548061M → MAFKEHGKITSCCIPGPINS SRAGAGAGASGWSSKGVRAR AREPERGAPDREPSDM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009288 mRNA Translation: BAA75899.1
AK222675 mRNA Translation: BAD96395.1
AK314182 mRNA Translation: BAG36863.1
AK293655 mRNA Translation: BAH11559.1
AL136295 Genomic DNA No translation available.
CH471078 Genomic DNA Translation: EAW66119.1
CH471078 Genomic DNA Translation: EAW66120.1
BC018046 mRNA Translation: AAH18046.1
CCDSiCCDS61413.1 [O95741-2]
CCDS9607.1 [O95741-1]
RefSeqiNP_001267487.1, NM_001280558.1 [O95741-2]
NP_006023.1, NM_006032.3 [O95741-1]
XP_005268273.1, XM_005268216.1
UniGeneiHs.6132

Genome annotation databases

EnsembliENST00000397016; ENSP00000380211; ENSG00000100884 [O95741-1]
ENST00000537691; ENSP00000440077; ENSG00000100884 [O95741-2]
ENST00000645359; ENSP00000494138; ENSG00000285221 [O95741-2]
ENST00000647071; ENSP00000494513; ENSG00000285221 [O95741-1]
GeneIDi9362
KEGGihsa:9362
UCSCiuc010tnv.4 human [O95741-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009288 mRNA Translation: BAA75899.1
AK222675 mRNA Translation: BAD96395.1
AK314182 mRNA Translation: BAG36863.1
AK293655 mRNA Translation: BAH11559.1
AL136295 Genomic DNA No translation available.
CH471078 Genomic DNA Translation: EAW66119.1
CH471078 Genomic DNA Translation: EAW66120.1
BC018046 mRNA Translation: AAH18046.1
CCDSiCCDS61413.1 [O95741-2]
CCDS9607.1 [O95741-1]
RefSeqiNP_001267487.1, NM_001280558.1 [O95741-2]
NP_006023.1, NM_006032.3 [O95741-1]
XP_005268273.1, XM_005268216.1
UniGeneiHs.6132

3D structure databases

ProteinModelPortaliO95741
SMRiO95741
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114763, 14 interactors
IntActiO95741, 12 interactors
MINTiO95741
STRINGi9606.ENSP00000216775

PTM databases

iPTMnetiO95741
PhosphoSitePlusiO95741

Polymorphism and mutation databases

BioMutaiCPNE6

Proteomic databases

EPDiO95741
MaxQBiO95741
PaxDbiO95741
PeptideAtlasiO95741
PRIDEiO95741
ProteomicsDBi51017

Protocols and materials databases

DNASUi9362
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397016; ENSP00000380211; ENSG00000100884 [O95741-1]
ENST00000537691; ENSP00000440077; ENSG00000100884 [O95741-2]
ENST00000645359; ENSP00000494138; ENSG00000285221 [O95741-2]
ENST00000647071; ENSP00000494513; ENSG00000285221 [O95741-1]
GeneIDi9362
KEGGihsa:9362
UCSCiuc010tnv.4 human [O95741-1]

Organism-specific databases

CTDi9362
EuPathDBiHostDB:ENSG00000100884.9
GeneCardsiCPNE6
HGNCiHGNC:2319 CPNE6
HPAiHPA031636
MIMi605688 gene
neXtProtiNX_O95741
OpenTargetsiENSG00000100884
PharmGKBiPA26836
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1327 Eukaryota
ENOG410XPC8 LUCA
GeneTreeiENSGT00760000119085
HOGENOMiHOG000220898
HOVERGENiHBG066841
InParanoidiO95741
OMAiITSYRRC
OrthoDBiEOG091G05IT
PhylomeDBiO95741
TreeFamiTF316419

Enzyme and pathway databases

ReactomeiR-HSA-1483206 Glycerophospholipid biosynthesis

Miscellaneous databases

GeneWikiiCPNE6
GenomeRNAii9362
PROiPR:O95741
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100884 Expressed in 113 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_CPNE6
ExpressionAtlasiO95741 baseline and differential
GenevisibleiO95741 HS

Family and domain databases

CDDicd04047 C2B_Copine, 1 hit
cd01459 vWA_copine_like, 1 hit
Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR037768 C2B_Copine
IPR010734 Copine
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF00168 C2, 2 hits
PF07002 Copine, 1 hit
SMARTiView protein in SMART
SM00239 C2, 2 hits
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50234 VWFA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCPNE6_HUMAN
AccessioniPrimary (citable) accession number: O95741
Secondary accession number(s): B2RAG6
, B7Z1M3, D3DS55, F5GXN1, Q53HA6, Q8WVG1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 7, 2005
Last modified: November 7, 2018
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again