Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O95718 (ERR2_HUMAN)

Entry version 205 (07 Apr 2021)
Sequence version 3 (07 Jun 2017)
Previous versions | rss
Add a publicationFeedback
Protein

Steroid hormone receptor ERR2

Gene

ESRRB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity (PubMed:17920186, PubMed:19755138). Plays a role, in a LIF-independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type (By similarity). Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1 (PubMed:23836911). Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity (PubMed:17920186, PubMed:19755138). During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program. Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation (By similarity).By similarity3 Publications
Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcription activity. Positively regulates ESR1 transcriptional activity upon E2 stimulation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei185Important for stabilizing DNA-binding1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi100 – 186Nuclear receptorPROSITE-ProRule annotationAdd BLAST87
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri103 – 123NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri139 – 163NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O95718

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-383280, Nuclear Receptor transcription pathway

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O95718

SIGNOR Signaling Network Open Resource

More...SIGNORi		O95718

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Steroid hormone receptor ERR2Curated
Alternative name(s):
ERR beta-2
Estrogen receptor-like 2
Estrogen-related receptor beta1 Publication
Short name:
ERR-beta
Nuclear receptor subfamily 3 group B member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ESRRBImported
Synonyms:ERRB2, ESRL2, NR3B2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3473, ESRRB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602167, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O95718

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000119715.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Deafness, autosomal recessive, 35 (DFNB35)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of non-syndromic deafness characterized by non-progressive, prelingual hearing loss.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043503110A → V in DFNB35. 1 PublicationCorresponds to variant dbSNP:rs121909110EnsemblClinVar.1
Natural variantiVAR_043504320L → P in DFNB35. 1 Publication1
Natural variantiVAR_043505342V → L in DFNB35. 1 PublicationCorresponds to variant dbSNP:rs121909111EnsemblClinVar.1
Natural variantiVAR_043506347L → P in DFNB35. 1 Publication1
Natural variantiVAR_043508389T → M in DFNB35; uncertain pathological significance. 1 PublicationCorresponds to variant dbSNP:rs201714970EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi185Y → A: 6-fold decrease in DNA-binding affinity. 1 Publication1

Keywords - Diseasei

Deafness, Disease variant, Non-syndromic deafness

Organism-specific databases

DisGeNET

More...DisGeNETi		2103

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		ESRRB

MalaCards human disease database

More...MalaCardsi		ESRRB
MIMi608565, phenotype

Open Targets

More...OpenTargetsi		ENSG00000119715

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		90636, Autosomal recessive non-syndromic sensorineural deafness type DFNB

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27889

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O95718, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3751

Drug and drug target database

More...DrugBanki		DB00255, Diethylstilbestrol
DB07776, Flavone
DB01645, Genistein

DrugCentral

More...DrugCentrali		O95718

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		623

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ESRRB

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000536621 – 433Steroid hormone receptor ERR2Add BLAST433

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated by PCAF/KAT2 (in vitro).1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O95718

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O95718

PeptideAtlas

More...PeptideAtlasi		O95718

PRoteomics IDEntifications database

More...PRIDEi		O95718

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51011 [O95718-1]
51012 [O95718-2]
51013 [O95718-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O95718

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O95718

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000119715, Expressed in cortex of kidney and 104 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O95718, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O95718, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000119715, Tissue enhanced (kidney, retina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds DNA as a monomer (PubMed:12654265).

Interacts with NR0B1; represses ESRRB activity at the GATA6 promoter.

Interacts with NANOG; reciprocally modulates their transcriptional activities and activates POU5F1 expression.

Interacts with NCOA3; mediates the interaction between ESRRB and RNA polymerase II complexes and allows NCOA3 corecruitment to ESRRB, KLF4, NANOG, and SOX2 enhancer regions to trigger ESRRB-dependent gene activation involved in self-renewal and pluripotency.

Interacts with KDM1A; co-occupes the core set of ESRRB targets including ELF5 and EOMES.

Interacts with the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and INTS12; ESRRB is probably not a core component of the integrator complex and associates to integrator via its interaction with INTS1 and INTS9; attracts the transcriptional machinery.

Interacts with JARID2.

Interacts with POU5F1; recruits ESRRB near the POU5F1-SOX2 element in the NANOG proximal promoter leading to activation of NANOG expression; the interaction is DNA independent (By similarity).

Interacts with NFE2L2; represses NFE2L2 transcriptional activity (PubMed:17920186).

Isoform 1 interacts with ESR1 (PubMed:19755138).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108406, 95 interactors

Protein interaction database and analysis system

More...IntActi		O95718, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000422488

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O95718

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O95718, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1433
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		O95718

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O95718

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O95718

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini208 – 432NR LBDPROSITE-ProRule annotationAdd BLAST225

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni93 – 211Interaction with NANOGBy similarityAdd BLAST119
Regioni203 – 433Essential for ESRRB transcriptional activity and interaction with NCOA3By similarityAdd BLAST231

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR3 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri103 – 123NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri139 – 163NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3575, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153433

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007368_11_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O95718

Identification of Orthologs from Complete Genome Data

More...OMAi		QIPGFIE

Database of Orthologous Groups

More...OrthoDBi		669799at2759

TreeFam database of animal gene trees

More...TreeFami		TF323751

Family and domain databases

Database of protein disorder

More...DisProti		DP01764

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00011

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR027289, Oest-rel_rcp
IPR024178, Oest_rcpt/oest-rel_rcp
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF002527, ER-like_NR, 1 hit
PIRSF500939, ERR1-2-3, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: O95718-3) [UniParc]FASTAAdd to basket
Also known as: ERRbeta-short-form1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSDDRHLGS SCGSFIKTEP SSPSSGIDAL SHHSPSGSSD ASGGFGLALG 
        60         70         80         90        100
THANGLDSPP MFAGAGLGGT PCRKSYEDCA SGIMEDSAIK CEYMLNAIPK 
       110        120        130        140        150
RLCLVCGDIA SGYHYGVASC EACKAFFKRT IQGNIEYSCP ATNECEITKR 
       160        170        180        190        200
RRKSCQACRF MKCLKVGMLK EGVRLDRVRG GRQKYKRRLD SESSPYLSLQ 
       210        220        230        240        250
ISPPAKKPLT KIVSYLLVAE PDKLYAMPPP GMPEGDIKAL TTLCDLADRE 
       260        270        280        290        300
LVVIIGWAKH IPGFSSLSLG DQMSLLQSAW MEILILGIVY RSLPYDDKLV 
       310        320        330        340        350
YAEDYIMDEE HSRLAGLLEL YRAILQLVRR YKKLKVEKEE FVTLKALALA 
       360        370        380        390        400
NSDSMYIEDL EAVQKLQDLL HEALQDYELS QRHEEPWRTG KLLLTLPLLR 
       410        420        430 
QTAAKAVQHF YSVKLQGKVP MHKLFLEMLE AKV
Length:433
Mass (Da):48,054
Last modified:June 7, 2017 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iED1D3F87E2798DD1
GO
Isoform 1 (identifier: O95718-1) [UniParc]FASTAAdd to basket
Also known as: ERRbeta2-delta101 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     433-433: V → VGQEQLRGSP...GQGKHLWLTM

Note: Primate-specific splicing isoform.1 Publication
Show »
Length:508
Mass (Da):56,208
Checksum:i1BF4637DC1D45B13
GO
Isoform 2 (identifier: O95718-2) [UniParc]FASTAAdd to basket
Also known as: ERRbeta21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     433-433: V → AWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFLPQRAGWPRAA

Note: Primate-specific splicing isoform.1 Publication
Show »
Length:500
Mass (Da):55,619
Checksum:iC219C84D914DF1C6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWD9E7EWD9_HUMAN
Steroid hormone receptor ERR2
ESRRB
438Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y491A0A2R8Y491_HUMAN
Steroid hormone receptor ERR2
ESRRB
454Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y509A0A2R8Y509_HUMAN
Steroid hormone receptor ERR2
ESRRB
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti248D → E in BAH02305 (Ref. 3) Curated1
Sequence conflicti429L → V in AAI31518 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043503110A → V in DFNB35. 1 PublicationCorresponds to variant dbSNP:rs121909110EnsemblClinVar.1
Natural variantiVAR_043504320L → P in DFNB35. 1 Publication1
Natural variantiVAR_043505342V → L in DFNB35. 1 PublicationCorresponds to variant dbSNP:rs121909111EnsemblClinVar.1
Natural variantiVAR_043506347L → P in DFNB35. 1 Publication1
Natural variantiVAR_043507386P → S1 PublicationCorresponds to variant dbSNP:rs61742642EnsemblClinVar.1
Natural variantiVAR_043508389T → M in DFNB35; uncertain pathological significance. 1 PublicationCorresponds to variant dbSNP:rs201714970EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_058967433V → VGQEQLRGSPKDERMSSHDG KCPFQSAAFTSRDQSNSPGI PNPRPSSPTPLNERGRQISP STRTPGGQGKHLWLTM in isoform 1. 1
Alternative sequenceiVSP_058968433V → AWARADSLQEWRPLEQVPSP LHRATKRQHVHFLTPLPPPP SVAWVGTAQAGYHLEVFLPQ RAGWPRAA in isoform 2. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF094517 mRNA Translation: AAC99409.1
AY451389 mRNA Translation: AAS15571.1
AY451390 mRNA Translation: AAS15572.1
AB307714 mRNA Translation: BAH02305.1
HQ692852 mRNA Translation: ADZ17363.1
AC008050 Genomic DNA Translation: AAG17472.1
AC016543 Genomic DNA No translation available.
BC131517 mRNA Translation: AAI31518.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS9850.2 [O95718-1]

NCBI Reference Sequences

More...RefSeqi		NP_004443.3, NM_004452.3 [O95718-1]
XP_016876575.1, XM_017021086.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000380887; ENSP00000370270; ENSG00000119715 [O95718-1]
ENST00000505752; ENSP00000423004; ENSG00000119715 [O95718-2]
ENST00000509242; ENSP00000422488; ENSG00000119715 [O95718-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2103

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2103

UCSC genome browser

More...UCSCi		uc001xsq.2, human [O95718-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF094517 mRNA Translation: AAC99409.1
AY451389 mRNA Translation: AAS15571.1
AY451390 mRNA Translation: AAS15572.1
AB307714 mRNA Translation: BAH02305.1
HQ692852 mRNA Translation: ADZ17363.1
AC008050 Genomic DNA Translation: AAG17472.1
AC016543 Genomic DNA No translation available.
BC131517 mRNA Translation: AAI31518.1
CCDSiCCDS9850.2 [O95718-1]
RefSeqiNP_004443.3, NM_004452.3 [O95718-1]
XP_016876575.1, XM_017021086.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LO1NMR-A97-192[»]
6LITX-ray2.00A/B204-433[»]
6LN4X-ray2.61A204-432[»]
BMRBiO95718
SMRiO95718
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108406, 95 interactors
IntActiO95718, 3 interactors
STRINGi9606.ENSP00000422488

Chemistry databases

BindingDBiO95718
ChEMBLiCHEMBL3751
DrugBankiDB00255, Diethylstilbestrol
DB07776, Flavone
DB01645, Genistein
DrugCentraliO95718
GuidetoPHARMACOLOGYi623

PTM databases

iPTMnetiO95718
PhosphoSitePlusiO95718

Genetic variation databases

BioMutaiESRRB

Proteomic databases

MassIVEiO95718
PaxDbiO95718
PeptideAtlasiO95718
PRIDEiO95718
ProteomicsDBi51011 [O95718-1]
51012 [O95718-2]
51013 [O95718-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		13059, 304 antibodies

The DNASU plasmid repository

More...DNASUi		2103

Genome annotation databases

EnsembliENST00000380887; ENSP00000370270; ENSG00000119715 [O95718-1]
ENST00000505752; ENSP00000423004; ENSG00000119715 [O95718-2]
ENST00000509242; ENSP00000422488; ENSG00000119715 [O95718-1]
GeneIDi2103
KEGGihsa:2103
UCSCiuc001xsq.2, human [O95718-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2103
DisGeNETi2103

GeneCards: human genes, protein and diseases

More...GeneCardsi		ESRRB
GeneReviewsiESRRB
HGNCiHGNC:3473, ESRRB
HPAiENSG00000119715, Tissue enhanced (kidney, retina)
MalaCardsiESRRB
MIMi602167, gene
608565, phenotype
neXtProtiNX_O95718
OpenTargetsiENSG00000119715
Orphaneti90636, Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBiPA27889
VEuPathDBiHostDB:ENSG00000119715.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3575, Eukaryota
GeneTreeiENSGT00940000153433
HOGENOMiCLU_007368_11_0_1
InParanoidiO95718
OMAiQIPGFIE
OrthoDBi669799at2759
TreeFamiTF323751

Enzyme and pathway databases

PathwayCommonsiO95718
ReactomeiR-HSA-383280, Nuclear Receptor transcription pathway
SignaLinkiO95718
SIGNORiO95718

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2103, 6 hits in 1015 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ESRRB, human
EvolutionaryTraceiO95718

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Estrogen-related_receptor_beta

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2103
PharosiO95718, Tchem

Protein Ontology

More...PROi		PR:O95718
RNActiO95718, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000119715, Expressed in cortex of kidney and 104 other tissues
ExpressionAtlasiO95718, baseline and differential
GenevisibleiO95718, HS

Family and domain databases

DisProtiDP01764
Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
IDEALiIID00011
InterProiView protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR027289, Oest-rel_rcp
IPR024178, Oest_rcpt/oest-rel_rcp
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PIRSFiPIRSF002527, ER-like_NR, 1 hit
PIRSF500939, ERR1-2-3, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiERR2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95718
Secondary accession number(s): A2VDJ2
, B6ZGU4, Q5F0P7, Q5F0P8, Q9HCB4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: June 7, 2017
Last modified: April 7, 2021
This is version 205 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again