Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O95704 (APBB3_HUMAN)

Entry version 170 (25 May 2022)
Sequence version 2 (30 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Amyloid-beta A4 precursor protein-binding family B member 3

Gene

APBB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May modulate the internalization of amyloid-beta precursor protein.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • amyloid-beta binding Source: GO_Central
  • low-density lipoprotein particle receptor binding Source: ARUK-UCL
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O95704

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O95704

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Amyloid-beta A4 precursor protein-binding family B member 3
Alternative name(s):
Protein Fe65-like 2
Short name:
Fe65L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:APBB3Imported
Synonyms:FE65L2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:20708, APBB3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602711, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O95704

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000113108

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10307

Open Targets

More...OpenTargetsi		ENSG00000113108

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134958636

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O95704, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		APBB3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000760541 – 486Amyloid-beta A4 precursor protein-binding family B member 3Add BLAST486

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O95704

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O95704

PeptideAtlas

More...PeptideAtlasi		O95704

PRoteomics IDEntifications database

More...PRIDEi		O95704

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		51002 [O95704-1]
51003 [O95704-2]
51004 [O95704-3]
51005 [O95704-4]
77814
79619

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O95704

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O95704

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in various tissues, highest expression in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000113108, Expressed in right ovary and 116 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O95704, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O95704, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000113108, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with APP (via intracellular domain) (PubMed:10081969).

Interacts with APLP1 and APLP2 (via intracellular domain) (PubMed:10081969).

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115593, 26 interactors

Protein interaction database and analysis system

More...IntActi		O95704, 24 interactors

Molecular INTeraction database

More...MINTi		O95704

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000346378

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O95704, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1486
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		O95704

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O95704

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O95704

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini29 – 61WWPROSITE-ProRule annotationAdd BLAST33
Domaini113 – 280PID 1PROSITE-ProRule annotationAdd BLAST168
Domaini285 – 440PID 2PROSITE-ProRule annotationAdd BLAST156

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QR5N, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000000002

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_093354_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O95704

Identification of Orthologs from Complete Genome Data

More...OMAi		LYMGILP

Database for complete collections of gene phylogenies

More...PhylomeDBi		O95704

TreeFam database of animal gene trees

More...TreeFami		TF314331

Family and domain databases

Conserved Domains Database

More...CDDi		cd00201, WW, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039576, APBB1/2/3
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001202, WW_dom
IPR036020, WW_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR14058, PTHR14058, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00640, PID, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00462, PTB, 2 hits
SM00456, WW, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF51045, SSF51045, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01179, PID, 2 hits
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform II (identifier: O95704-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGKDYMLAI ILVNCDDDLW GDHSLEVEAG LPPGWRKIHD AAGTYYWHVP 
        60         70         80         90        100
SGSTQWQRPT WELGDAEDPG TGTEGIWGLR PPKGRSFSSL ESSLDRSNSL 
       110        120        130        140        150
SWYGGESYIQ SMEPGAKCFA VRSLGWVEVP EEDLAPGKSS IAVNNCIQQL 
       160        170        180        190        200
AQTRSRSQPP DGAWGEGQNM LMILKKDAMS LVNPLDHSLI HCQPLVHIRV 
       210        220        230        240        250
WGVGSSKGRD RDFAFVASDK DSCMLKCHVF CCDVPAKAIA SALHGLCAQI 
       260        270        280        290        300
LSERVEVSGD ASCCSPDPIS PEDLPRQVEL LDAVSQAAQK YEALYMGTLP 
       310        320        330        340        350
VTKAMGMDVL NEAIGTLTAR GDRNAWVPTM LSVSDSLMTA HPIQAEASTE 
       360        370        380        390        400
EEPLWQCPVR LVTFIGVGRD PHTFGLIADL GRQSFQCAAF WCQPHAGGLS 
       410        420        430        440        450
EAVQAACMVQ YQKCLVASAA RGKAWGAQAR ARLRLKRTSS MDSPGGPLPL 
       460        470        480 
PLLKGGVGGA GATPRKRGVF SFLDAFRLKP SLLHMP
Length:486
Mass (Da):52,585
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i553DFB4D8655EFA1
GO
Isoform I (identifier: O95704-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-211: Missing.

Show »
Length:484
Mass (Da):52,314
Checksum:i2A57615AAA0CF980
GO
Isoform III (identifier: O95704-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: D → PISAPA

Show »
Length:491
Mass (Da):53,007
Checksum:i054A8696C11578E2
GO
Isoform IV (identifier: O95704-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: D → DSPISAPA

Show »
Length:493
Mass (Da):53,209
Checksum:i5EC279FAAE2EEF96
GO
Isoform I-214 (identifier: O95704-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-214: VHIRVWGVGSSKGRDRDFA → AVIPTDADPQYLNPWTQIL
     215-486: Missing.

Note: Increased expression upon apoptotic stimuli.Curated
Show »
Length:214
Mass (Da):23,634
Checksum:iFD469DC121C73E6C
GO
Isoform I-245 (identifier: O95704-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-245: DRDFAFVASDKDSCMLKCHVFCCDVPAKAIASALHG → SSDVDPGLLPLPGPALVGEGGPSSAGTVWGESERLG
     246-486: Missing.

Show »
Length:245
Mass (Da):26,460
Checksum:i7F460206E4157F6C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBA1D6RBA1_HUMAN
Amyloid-beta A4 precursor protein-b...
APBB3
337Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EX91E7EX91_HUMAN
Amyloid-beta A4 precursor protein-b...
APBB3
339Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJB2D6RJB2_HUMAN
Amyloid-beta A4 precursor protein-b...
APBB3
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029518165G → R. Corresponds to variant dbSNP:rs7715021Ensembl.1
Natural variantiVAR_024702231C → R5 PublicationsCorresponds to variant dbSNP:rs250430Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047811196 – 214VHIRV…DRDFA → AVIPTDADPQYLNPWTQIL in isoform I-214. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_047812210 – 245DRDFA…SALHG → SSDVDPGLLPLPGPALVGEG GPSSAGTVWGESERLG in isoform I-245. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_006799210 – 211Missing in isoform I. 2 Publications2
Alternative sequenceiVSP_006800210D → PISAPA in isoform III. 1 Publication1
Alternative sequenceiVSP_006801210D → DSPISAPA in isoform IV. 1 Publication1
Alternative sequenceiVSP_047813215 – 486Missing in isoform I-214. 1 PublicationAdd BLAST272
Alternative sequenceiVSP_047814246 – 486Missing in isoform I-245. 1 PublicationAdd BLAST241

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB018247 mRNA Translation: BAA35188.1
AB024745 Genomic DNA Translation: BAA78674.1
AB049618 mRNA Translation: BAB40806.1
AB061224 mRNA Translation: BAB71767.1
AF224708 mRNA Translation: AAF65172.1
AF224709 mRNA Translation: AAF65173.1
AF224710 mRNA Translation: AAF65174.1
AF224711 mRNA Translation: AAF65175.1
AK075280 mRNA Translation: BAG52101.1
AC011399 Genomic DNA No translation available.
AC116353 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62041.1
BC125187 mRNA Translation: AAI25188.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4227.1 [O95704-4]
CCDS4228.1 [O95704-3]
CCDS4229.1 [O95704-1]
CCDS47279.1 [O95704-2]

NCBI Reference Sequences

More...RefSeqi		NP_006042.3, NM_006051.3 [O95704-4]
NP_573418.2, NM_133172.2 [O95704-3]
NP_573419.2, NM_133173.2 [O95704-1]
NP_573420.2, NM_133174.2 [O95704-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000354402.9; ENSP00000346378.5; ENSG00000113108.20 [O95704-4]
ENST00000356738.6; ENSP00000349177.2; ENSG00000113108.20 [O95704-3]
ENST00000357560.9; ENSP00000350171.4; ENSG00000113108.20
ENST00000412920.7; ENSP00000402591.3; ENSG00000113108.20 [O95704-2]
ENST00000467078.5; ENSP00000422718.1; ENSG00000113108.20 [O95704-6]
ENST00000509914.5; ENSP00000426107.1; ENSG00000113108.20 [O95704-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10307

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10307

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000357560.9; ENSP00000350171.4; NM_133173.3; NP_573419.2

UCSC genome browser

More...UCSCi		uc003lgd.2, human [O95704-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018247 mRNA Translation: BAA35188.1
AB024745 Genomic DNA Translation: BAA78674.1
AB049618 mRNA Translation: BAB40806.1
AB061224 mRNA Translation: BAB71767.1
AF224708 mRNA Translation: AAF65172.1
AF224709 mRNA Translation: AAF65173.1
AF224710 mRNA Translation: AAF65174.1
AF224711 mRNA Translation: AAF65175.1
AK075280 mRNA Translation: BAG52101.1
AC011399 Genomic DNA No translation available.
AC116353 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62041.1
BC125187 mRNA Translation: AAI25188.1
CCDSiCCDS4227.1 [O95704-4]
CCDS4228.1 [O95704-3]
CCDS4229.1 [O95704-1]
CCDS47279.1 [O95704-2]
RefSeqiNP_006042.3, NM_006051.3 [O95704-4]
NP_573418.2, NM_133172.2 [O95704-3]
NP_573419.2, NM_133173.2 [O95704-1]
NP_573420.2, NM_133174.2 [O95704-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DYQX-ray3.10A281-417[»]
2YSCNMR-A30-61[»]
AlphaFoldDBiO95704
SMRiO95704
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115593, 26 interactors
IntActiO95704, 24 interactors
MINTiO95704
STRINGi9606.ENSP00000346378

PTM databases

iPTMnetiO95704
PhosphoSitePlusiO95704

Genetic variation databases

BioMutaiAPBB3

Proteomic databases

MassIVEiO95704
PaxDbiO95704
PeptideAtlasiO95704
PRIDEiO95704
ProteomicsDBi51002 [O95704-1]
51003 [O95704-2]
51004 [O95704-3]
51005 [O95704-4]
77814
79619

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1613, 184 antibodies from 22 providers

The DNASU plasmid repository

More...DNASUi		10307

Genome annotation databases

EnsembliENST00000354402.9; ENSP00000346378.5; ENSG00000113108.20 [O95704-4]
ENST00000356738.6; ENSP00000349177.2; ENSG00000113108.20 [O95704-3]
ENST00000357560.9; ENSP00000350171.4; ENSG00000113108.20
ENST00000412920.7; ENSP00000402591.3; ENSG00000113108.20 [O95704-2]
ENST00000467078.5; ENSP00000422718.1; ENSG00000113108.20 [O95704-6]
ENST00000509914.5; ENSP00000426107.1; ENSG00000113108.20 [O95704-5]
GeneIDi10307
KEGGihsa:10307
MANE-SelectiENST00000357560.9; ENSP00000350171.4; NM_133173.3; NP_573419.2
UCSCiuc003lgd.2, human [O95704-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10307
DisGeNETi10307

GeneCards: human genes, protein and diseases

More...GeneCardsi		APBB3
HGNCiHGNC:20708, APBB3
HPAiENSG00000113108, Tissue enhanced (brain)
MIMi602711, gene
neXtProtiNX_O95704
OpenTargetsiENSG00000113108
PharmGKBiPA134958636
VEuPathDBiHostDB:ENSG00000113108

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QR5N, Eukaryota
GeneTreeiENSGT00390000000002
HOGENOMiCLU_093354_0_0_1
InParanoidiO95704
OMAiLYMGILP
PhylomeDBiO95704
TreeFamiTF314331

Enzyme and pathway databases

PathwayCommonsiO95704
SignaLinkiO95704

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10307, 10 hits in 1075 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		APBB3, human
EvolutionaryTraceiO95704

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		APBB3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10307
PharosiO95704, Tbio

Protein Ontology

More...PROi		PR:O95704
RNActiO95704, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000113108, Expressed in right ovary and 116 other tissues
ExpressionAtlasiO95704, baseline and differential
GenevisibleiO95704, HS

Family and domain databases

CDDicd00201, WW, 1 hit
Gene3Di2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR039576, APBB1/2/3
IPR011993, PH-like_dom_sf
IPR006020, PTB/PI_dom
IPR001202, WW_dom
IPR036020, WW_dom_sf
PANTHERiPTHR14058, PTHR14058, 1 hit
PfamiView protein in Pfam
PF00640, PID, 1 hit
SMARTiView protein in SMART
SM00462, PTB, 2 hits
SM00456, WW, 1 hit
SUPFAMiSSF51045, SSF51045, 1 hit
PROSITEiView protein in PROSITE
PS01179, PID, 2 hits
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAPBB3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95704
Secondary accession number(s): B3KQN9
, Q08AG4, Q96Q18, Q9BYD4, Q9NYX6, Q9NYX7, Q9NYX8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: November 30, 2010
Last modified: May 25, 2022
This is version 170 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again