Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 4

Gene

CNOT4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins (PubMed:11823428, PubMed:22159038, PubMed:26575292). Involved in activation of the JAK/STAT pathway (PubMed:11823428, PubMed:22159038). Catalyzes ubiquitination of methylated RBM15 (PubMed:26575292).3 Publications

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.2 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.1 Publication
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri14 – 57RING-type; degeneratePROSITE-ProRule annotationAdd BLAST44
Zinc fingeri190 – 217C3H1-typePROSITE-ProRule annotationAdd BLAST28

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • RNA binding Source: UniProtKB
  • ubiquitin-protein transferase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRNA-binding, Transferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 4 (EC:2.3.2.272 Publications)
Alternative name(s):
CCR4-associated factor 4
E3 ubiquitin-protein ligase CNOT4
Potential transcriptional repressor NOT4Hp
RING-type E3 ubiquitin transferase CNOT4Curated
Gene namesi
Name:CNOT4
Synonyms:NOT4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000080802.18
HGNCiHGNC:7880 CNOT4
MIMi604911 gene
neXtProtiNX_O95628

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi16L → A or E: Abolishes interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi17C → A: Abolishes interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi18M → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi33C → R: Abolishes interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi42W → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi44R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi45I → A or W: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi49E → A: Strongly reduces interaction with E2 ubiquitin ligases. 2 Publications1
Mutagenesisi49E → K: Strongly reduced interaction with UBE2D2. 2 Publications1
Mutagenesisi54P → A: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1
Mutagenesisi57R → A or E: Strongly reduces interaction with E2 ubiquitin ligases. 1 Publication1

Organism-specific databases

DisGeNETi4850
OpenTargetsiENSG00000080802
PharmGKBiPA26675

Polymorphism and mutation databases

BioMutaiCNOT4

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000816791 – 575CCR4-NOT transcription complex subunit 4Add BLAST575

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei71PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei475Asymmetric dimethylarginineCombined sources1
Modified residuei483Asymmetric dimethylarginineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei497Asymmetric dimethylarginineCombined sources1

Post-translational modificationi

Autoubiquitinated.2 Publications

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiO95628
PaxDbiO95628
PeptideAtlasiO95628
PRIDEiO95628
ProteomicsDBi50958
50959 [O95628-2]
50960 [O95628-3]
50961 [O95628-4]
50962 [O95628-5]
50963 [O95628-6]
50964 [O95628-7]
50965 [O95628-8]

PTM databases

iPTMnetiO95628
PhosphoSitePlusiO95628

Expressioni

Gene expression databases

BgeeiENSG00000080802 Expressed in 232 organ(s), highest expression level in corpus callosum
CleanExiHS_CNOT4
ExpressionAtlasiO95628 baseline and differential
GenevisibleiO95628 HS

Organism-specific databases

HPAiHPA005737

Interactioni

Subunit structurei

Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2.3 Publications

Protein-protein interaction databases

BioGridi110912, 20 interactors
IntActiO95628, 11 interactors
STRINGi9606.ENSP00000445508

Structurei

Secondary structure

1575
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO95628
SMRiO95628
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO95628

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini109 – 189RRMPROSITE-ProRule annotationAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili68 – 104Sequence analysisAdd BLAST37

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri14 – 57RING-type; degeneratePROSITE-ProRule annotationAdd BLAST44
Zinc fingeri190 – 217C3H1-typePROSITE-ProRule annotationAdd BLAST28

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG2068 Eukaryota
COG5175 LUCA
GeneTreeiENSGT00390000000068
HOGENOMiHOG000065696
HOVERGENiHBG051043
InParanoidiO95628
KOiK10643
OMAiASWNPYS
OrthoDBiEOG091G03YT
PhylomeDBiO95628
TreeFamiTF106134

Family and domain databases

CDDicd16618 mRING-HC-C4C4_CNOT4, 1 hit
cd12438 RRM_CNOT4, 1 hit
Gene3Di3.30.40.10, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR034261 CNOT4_RRM
IPR039780 Mot2
IPR039515 NOT4_mRING-HC-C4C4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
IPR000571 Znf_CCCH
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR12603 PTHR12603, 2 hits
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00361 RRM_1, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50103 ZF_C3H1, 1 hit
PS50089 ZF_RING_2, 1 hit

Sequences (10+)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95628-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRSPDAKED PVECPLCMEP LEIDDINFFP CTCGYQICRF CWHRIRTDEN
60 70 80 90 100
GLCPACRKPY PEDPAVYKPL SQEELQRIKN EKKQKQNERK QKISENRKHL
110 120 130 140 150
ASVRVVQKNL VFVVGLSQRL ADPEVLKRPE YFGKFGKIHK VVINNSTSYA
160 170 180 190 200
GSQGPSASAY VTYIRSEDAL RAIQCVNNVV VDGRTLKASL GTTKYCSYFL
210 220 230 240 250
KNMQCPKPDC MYLHELGDEA ASFTKEEMQA GKHQEYEQKL LQELYKLNPN
260 270 280 290 300
FLQLSTGSVD KNKNKVTPLQ RYDTPIDKPS DSLSIGNGDN SQQISNSDTP
310 320 330 340 350
SPPPGLSKSN PVIPISSSNH SARSPFEGAV TESQSLFSDN FRHPNPIPSG
360 370 380 390 400
LPPFPSSPQT SSDWPTAPEP QSLFTSETIP VSSSTDWQAA FGFGSSKQPE
410 420 430 440 450
DDLGFDPFDV TRKALADLIE KELSVQDQPS LSPTSLQNSS SHTTTAKGPG
460 470 480 490 500
SGFLHPAAAT NANSLNSTFS VLPQRFPQFQ QHRAVYNSFS FPGQAARYPW
510 520 530 540 550
MAFPRNSIMH LNHTANPTSN SNFLDLNLPP QHNTGLGGIP VAGEEEVKVS
560 570
TMPLSTSSHS LQQGQQPTSL HTTVA
Length:575
Mass (Da):63,510
Last modified:October 3, 2006 - v3
Checksum:iC41762D4EC4222BC
GO
Isoform 2 (identifier: O95628-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S

Show »
Length:572
Mass (Da):63,062
Checksum:i717835C74D66B540
GO
Isoform 3 (identifier: O95628-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: Missing.

Note: No experimental confirmation available.
Show »
Length:558
Mass (Da):61,651
Checksum:iDAE0356900B05FE4
GO
Isoform 4 (identifier: O95628-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH

Note: No experimental confirmation available.
Show »
Length:642
Mass (Da):70,787
Checksum:i3D432CA88242C77E
GO
Isoform 5 (identifier: O95628-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-433: IEKELSVQDQPSLSP → TEPIERKRLAVLKRR
     434-575: Missing.

Show »
Length:433
Mass (Da):48,485
Checksum:i8B120FF952B46883
GO
Isoform 6 (identifier: O95628-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSIESLN...HLFINCKNFC

Note: No experimental confirmation available.
Show »
Length:767
Mass (Da):84,747
Checksum:i43A198C595008B1C
GO
Isoform 7 (identifier: O95628-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...PTAPFSSLMF

Note: No experimental confirmation available.
Show »
Length:675
Mass (Da):74,524
Checksum:iFA54396714B4A41B
GO
Isoform 8 (identifier: O95628-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S
     544-575: EEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → IPASSGNSLD...LLQSSTLDRH

Note: No experimental confirmation available.
Show »
Length:639
Mass (Da):70,339
Checksum:iC22E9F609FFFF456
GO
Isoform 9 (identifier: O95628-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH

Note: No experimental confirmation available.Curated
Show »
Length:710
Mass (Da):77,809
Checksum:i118DE9B8D4B7AD79
GO
Isoform 10 (identifier: O95628-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA → DNSSSVESLN...LLQSSTLDRH

Note: No experimental confirmation available.
Show »
Length:713
Mass (Da):78,257
Checksum:iA66182988D096173
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRD2A0A0A0MRD2_HUMAN
CCR4-NOT transcription complex subu...
CNOT4
175Annotation score:

Sequence cautioni

The sequence AAC72963 differs from that shown. Sequencing errors.Curated
The sequence AAC72963 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAD00180 differs from that shown. Reason: Frameshift at positions 358 and 400.Curated
The sequence BAC11125 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti178N → D in BAH13270 (PubMed:14702039).Curated1
Sequence conflicti201K → R in BAH13270 (PubMed:14702039).Curated1
Sequence conflicti340N → I in AAH35590 (PubMed:15489334).Curated1
Sequence conflicti570L → F in AAD00179 (Ref. 1) Curated1
Sequence conflicti570L → F in AAD00180 (Ref. 1) Curated1
Isoform 9 (identifier: O95628-9)
Sequence conflicti545V → I in BAH13270 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0278337A → G1 PublicationCorresponds to variant dbSNP:rs17480616Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0099231 – 17Missing in isoform 3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_009924271 – 274RYDT → S in isoform 2, isoform 8 and isoform 9. 3 Publications4
Alternative sequenceiVSP_009925419 – 433IEKEL…PSLSP → TEPIERKRLAVLKRR in isoform 5. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_009926434 – 575Missing in isoform 5. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_009927543 – 575GEEEV…HTTVA → DNSSSIESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPQIYYRVQHWTAIRQ RGATIRKCRICPTLFSPSQP TTHSSLLISYVLKNPVPDQF FFSLTPDAMRSQGHYHLFIN CKNFC in isoform 6. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_045469543 – 575GEEEV…HTTVA → DNSSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSLSWDS PGSWTDPAIITGIPASSGNS LDSLQDDNPPHWLKSLQALT EMDGPSAAPSQTHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 9 and isoform 10. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_009928544 – 575EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGPSAAPSQT HHSAPFSTQIPLHRASWNPY PPPSNPSSFHSPPPGFQTAF RPPSKTPTDLLQSSTLDRH in isoform 4 and isoform 8. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_009929544 – 575EEEVK…HTTVA → IPASSGNSLDSLQDDNPPHW LKSLQALTEMDGQRCSITDP PQRPLQHTDPAAQSQLESLP SSFKPFQLPLPTPRLSDGLQ TPQQNPHRFTTEFNTGPPLG KEEQPLENAGFVPLCFLPLS PPPTAPFSSLMF in isoform 7. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71267 mRNA Translation: AAD00179.1 Frameshift.
U71268 mRNA Translation: AAD00180.1 Frameshift.
AF180475 mRNA Translation: AAF29829.1
AL389980 mRNA Translation: CAB97536.1
AK074671 mRNA Translation: BAC11125.1 Different initiation.
AK300365 mRNA Translation: BAH13270.1
AC083871 Genomic DNA No translation available.
AC074002 Genomic DNA No translation available.
BC035590 mRNA Translation: AAH35590.1
AF091094 mRNA Translation: AAC72963.1 Sequence problems.
CCDSiCCDS43650.1 [O95628-8]
CCDS47719.1 [O95628-2]
CCDS55164.1 [O95628-4]
CCDS55165.1 [O95628-10]
CCDS55166.1 [O95628-1]
CCDS55167.1 [O95628-9]
RefSeqiNP_001008226.1, NM_001008225.2 [O95628-2]
NP_001177776.1, NM_001190847.1 [O95628-4]
NP_001177777.1, NM_001190848.1 [O95628-1]
NP_001177778.1, NM_001190849.1 [O95628-9]
NP_001177779.1, NM_001190850.1 [O95628-10]
NP_037448.2, NM_013316.3 [O95628-8]
XP_016867724.1, XM_017012235.1 [O95628-10]
UniGeneiHs.490224

Genome annotation databases

EnsembliENST00000315544; ENSP00000326731; ENSG00000080802 [O95628-1]
ENST00000361528; ENSP00000354673; ENSG00000080802 [O95628-8]
ENST00000414802; ENSP00000416532; ENSG00000080802 [O95628-5]
ENST00000423368; ENSP00000406777; ENSG00000080802 [O95628-4]
ENST00000428680; ENSP00000399108; ENSG00000080802 [O95628-2]
ENST00000451834; ENSP00000388491; ENSG00000080802 [O95628-9]
ENST00000541284; ENSP00000445508; ENSG00000080802 [O95628-10]
GeneIDi4850
KEGGihsa:4850
UCSCiuc003vss.4 human [O95628-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71267 mRNA Translation: AAD00179.1 Frameshift.
U71268 mRNA Translation: AAD00180.1 Frameshift.
AF180475 mRNA Translation: AAF29829.1
AL389980 mRNA Translation: CAB97536.1
AK074671 mRNA Translation: BAC11125.1 Different initiation.
AK300365 mRNA Translation: BAH13270.1
AC083871 Genomic DNA No translation available.
AC074002 Genomic DNA No translation available.
BC035590 mRNA Translation: AAH35590.1
AF091094 mRNA Translation: AAC72963.1 Sequence problems.
CCDSiCCDS43650.1 [O95628-8]
CCDS47719.1 [O95628-2]
CCDS55164.1 [O95628-4]
CCDS55165.1 [O95628-10]
CCDS55166.1 [O95628-1]
CCDS55167.1 [O95628-9]
RefSeqiNP_001008226.1, NM_001008225.2 [O95628-2]
NP_001177776.1, NM_001190847.1 [O95628-4]
NP_001177777.1, NM_001190848.1 [O95628-1]
NP_001177778.1, NM_001190849.1 [O95628-9]
NP_001177779.1, NM_001190850.1 [O95628-10]
NP_037448.2, NM_013316.3 [O95628-8]
XP_016867724.1, XM_017012235.1 [O95628-10]
UniGeneiHs.490224

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1E4UNMR-A1-78[»]
1UR6NMR-B12-63[»]
ProteinModelPortaliO95628
SMRiO95628
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110912, 20 interactors
IntActiO95628, 11 interactors
STRINGi9606.ENSP00000445508

PTM databases

iPTMnetiO95628
PhosphoSitePlusiO95628

Polymorphism and mutation databases

BioMutaiCNOT4

Proteomic databases

MaxQBiO95628
PaxDbiO95628
PeptideAtlasiO95628
PRIDEiO95628
ProteomicsDBi50958
50959 [O95628-2]
50960 [O95628-3]
50961 [O95628-4]
50962 [O95628-5]
50963 [O95628-6]
50964 [O95628-7]
50965 [O95628-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315544; ENSP00000326731; ENSG00000080802 [O95628-1]
ENST00000361528; ENSP00000354673; ENSG00000080802 [O95628-8]
ENST00000414802; ENSP00000416532; ENSG00000080802 [O95628-5]
ENST00000423368; ENSP00000406777; ENSG00000080802 [O95628-4]
ENST00000428680; ENSP00000399108; ENSG00000080802 [O95628-2]
ENST00000451834; ENSP00000388491; ENSG00000080802 [O95628-9]
ENST00000541284; ENSP00000445508; ENSG00000080802 [O95628-10]
GeneIDi4850
KEGGihsa:4850
UCSCiuc003vss.4 human [O95628-1]

Organism-specific databases

CTDi4850
DisGeNETi4850
EuPathDBiHostDB:ENSG00000080802.18
GeneCardsiCNOT4
H-InvDBiHIX0007112
HGNCiHGNC:7880 CNOT4
HPAiHPA005737
MIMi604911 gene
neXtProtiNX_O95628
OpenTargetsiENSG00000080802
PharmGKBiPA26675
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2068 Eukaryota
COG5175 LUCA
GeneTreeiENSGT00390000000068
HOGENOMiHOG000065696
HOVERGENiHBG051043
InParanoidiO95628
KOiK10643
OMAiASWNPYS
OrthoDBiEOG091G03YT
PhylomeDBiO95628
TreeFamiTF106134

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

ChiTaRSiCNOT4 human
EvolutionaryTraceiO95628
GenomeRNAii4850
PROiPR:O95628
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000080802 Expressed in 232 organ(s), highest expression level in corpus callosum
CleanExiHS_CNOT4
ExpressionAtlasiO95628 baseline and differential
GenevisibleiO95628 HS

Family and domain databases

CDDicd16618 mRING-HC-C4C4_CNOT4, 1 hit
cd12438 RRM_CNOT4, 1 hit
Gene3Di3.30.40.10, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR034261 CNOT4_RRM
IPR039780 Mot2
IPR039515 NOT4_mRING-HC-C4C4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
IPR000571 Znf_CCCH
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR12603 PTHR12603, 2 hits
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00361 RRM_1, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50103 ZF_C3H1, 1 hit
PS50089 ZF_RING_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCNOT4_HUMAN
AccessioniPrimary (citable) accession number: O95628
Secondary accession number(s): B7Z6I4
, E7ET38, F8VQP3, O95339, O95627, Q8IYM7, Q8NCL0, Q9NPQ1, Q9NZN6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 3, 2006
Last modified: November 7, 2018
This is version 171 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again