Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NAD kinase

Gene

NADK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cation1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=3.3 mM for ATP1 Publication
  2. KM=0.54 mM for NAD1 Publication
  1. Vmax=6.7 µmol/min/mg enzyme1 Publication

pH dependencei

Optimum pH is 7.5.1 Publication

Temperature dependencei

Optimum temperature is 55 degrees Celsius.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • NAD+ kinase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Metal-binding, NAD, NADP, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS00233-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.23 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-196807 Nicotinate metabolism

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
O95544

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NAD kinase (EC:2.7.1.23)
Alternative name(s):
Poly(P)/ATP NAD kinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NADK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000008130.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29831 NADK

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611616 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95544

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65220

Open Targets

More...
OpenTargetsi
ENSG00000008130

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671298

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6177

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NADK

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001207131 – 446NAD kinaseAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei46PhosphoserineCombined sources1
Modified residuei48PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Modified residuei55PhosphoserineCombined sources1
Modified residuei64PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95544

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95544

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95544

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95544

PeptideAtlas

More...
PeptideAtlasi
O95544

PRoteomics IDEntifications database

More...
PRIDEi
O95544

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50936

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95544

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95544

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed but not detected in skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000008130 Expressed in 227 organ(s), highest expression level in vagina

CleanEx database of gene expression profiles

More...
CleanExi
HS_NADK

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95544 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95544 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048909
HPA053368

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122408, 68 interactors

Protein interaction database and analysis system

More...
IntActi
O95544, 11 interactors

Molecular INTeraction database

More...
MINTi
O95544

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000340925

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O95544

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1446
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3PFNX-ray2.70A/B/C/D68-426[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95544

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95544

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O95544

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi326 – 333Poly-Ala8
Compositional biasi437 – 445Poly-Glu9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NAD kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2178 Eukaryota
COG0061 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013792

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000176769

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG008249

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95544

KEGG Orthology (KO)

More...
KOi
K00858

Database of Orthologous Groups

More...
OrthoDBi
1263874at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95544

TreeFam database of animal gene trees

More...
TreeFami
TF324076

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.200.30, 1 hit
3.40.50.10330, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00361 NAD_kinase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017438 ATP-NAD_kinase_N
IPR017437 ATP-NAD_kinase_PpnK-typ_C
IPR016064 NAD/diacylglycerol_kinase_sf
IPR002504 NADK

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01513 NAD_kinase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111331 SSF111331, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95544-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEMEQEKMTM NKELSPDAAA YCCSACHGDE TWSYNHPIRG RAKSRSLSAS
60 70 80 90 100
PALGSTKEFR RTRSLHGPCP VTTFGPKACV LQNPQTIMHI QDPASQRLTW
110 120 130 140 150
NKSPKSVLVI KKMRDASLLQ PFKELCTHLM EENMIVYVEK KVLEDPAIAS
160 170 180 190 200
DESFGAVKKK FCTFREDYDD ISNQIDFIIC LGGDGTLLYA SSLFQGSVPP
210 220 230 240 250
VMAFHLGSLG FLTPFSFENF QSQVTQVIEG NAAVVLRSRL KVRVVKELRG
260 270 280 290 300
KKTAVHNGLG ENGSQAAGLD MDVGKQAMQY QVLNEVVIDR GPSSYLSNVD
310 320 330 340 350
VYLDGHLITT VQGDGVIVST PTGSTAYAAA AGASMIHPNV PAIMITPICP
360 370 380 390 400
HSLSFRPIVV PAGVELKIML SPEARNTAWV SFDGRKRQEI RHGDSISITT
410 420 430 440
SCYPLPSICV RDPVSDWFES LAQCLHWNVR KKQAHFEEEE EEEEEG
Length:446
Mass (Da):49,228
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48CE7AF05EDD7E8B
GO
Isoform 2 (identifier: O95544-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: M → IATPLSLASQ...AGMGVGQATG
     131-131: E → EARGAGGKGAWGAHGVGGASIHITAPRVGSAGGMSRLALCFQ

Show »
Length:591
Mass (Da):63,456
Checksum:i9F81E711739713BA
GO
Isoform 3 (identifier: O95544-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-87: NKELSPDAAA...ACVLQNPQTI → GRPRVRQAWP...DPTPPSNACT

Show »
Length:423
Mass (Da):46,446
Checksum:iD83B07A90D5B6D0A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MR98A0A0A0MR98_HUMAN
NAD kinase
NADK
414Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRC0J3QRC0_HUMAN
NAD kinase
NADK
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTI3J3KTI3_HUMAN
NAD kinase
NADK
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSP9J3KSP9_HUMAN
NAD kinase
NADK
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR86J3QR86_HUMAN
NAD kinase
NADK
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti363Missing in AAG44568 (Ref. 2) Curated1
Sequence conflicti445E → EE in BAB14412 (Ref. 2) Curated1
Sequence conflicti446G → EG in BAH12420 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034119262N → K2 PublicationsCorresponds to variant dbSNP:rs4751Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04731211 – 87NKELS…NPQTI → GRPRVRQAWPGCCGHTGRLP AGRGYLASHMCDPAGAELIG DGMSDPTPPSNACT in isoform 3. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_04731388M → IATPLSLASQLLPSPAVSHS GQGGVTGQVHVLPQPSDQGV LSGPRAARGQTAPQEEAVTQ EEVEALVCGHTQRWVPGPVY DAAAGGSGWAQLSLRAGMGV GQATG in isoform 2. 1 Publication1
Alternative sequenceiVSP_047314131E → EARGAGGKGAWGAHGVGGAS IHITAPRVGSAGGMSRLALC FQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY090771 mRNA Translation: AAM01195.1
AF250320 mRNA Translation: AAG44568.1
AK023114 mRNA Translation: BAB14412.1
AK290161 mRNA Translation: BAF82850.1
AK296722 mRNA Translation: BAH12420.1
AL031282 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56151.1
CH471183 Genomic DNA Translation: EAW56152.1
BC001709 mRNA Translation: AAH01709.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30565.1 [O95544-1]
CCDS55562.1 [O95544-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001185922.1, NM_001198993.1 [O95544-1]
NP_001185923.1, NM_001198994.1 [O95544-2]
NP_001185924.1, NM_001198995.1
NP_075394.3, NM_023018.4 [O95544-1]
XP_005244835.1, XM_005244778.2
XP_006710900.1, XM_006710837.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654792
Hs.731532
Hs.733075

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341426; ENSP00000341679; ENSG00000008130 [O95544-1]
ENST00000341991; ENSP00000344340; ENSG00000008130 [O95544-1]
ENST00000378625; ENSP00000367890; ENSG00000008130 [O95544-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65220

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65220

UCSC genome browser

More...
UCSCi
uc001aic.3 human [O95544-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY090771 mRNA Translation: AAM01195.1
AF250320 mRNA Translation: AAG44568.1
AK023114 mRNA Translation: BAB14412.1
AK290161 mRNA Translation: BAF82850.1
AK296722 mRNA Translation: BAH12420.1
AL031282 Genomic DNA No translation available.
CH471183 Genomic DNA Translation: EAW56151.1
CH471183 Genomic DNA Translation: EAW56152.1
BC001709 mRNA Translation: AAH01709.1
CCDSiCCDS30565.1 [O95544-1]
CCDS55562.1 [O95544-2]
RefSeqiNP_001185922.1, NM_001198993.1 [O95544-1]
NP_001185923.1, NM_001198994.1 [O95544-2]
NP_001185924.1, NM_001198995.1
NP_075394.3, NM_023018.4 [O95544-1]
XP_005244835.1, XM_005244778.2
XP_006710900.1, XM_006710837.2
UniGeneiHs.654792
Hs.731532
Hs.733075

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3PFNX-ray2.70A/B/C/D68-426[»]
ProteinModelPortaliO95544
SMRiO95544
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122408, 68 interactors
IntActiO95544, 11 interactors
MINTiO95544
STRINGi9606.ENSP00000340925

Chemistry databases

BindingDBiO95544
ChEMBLiCHEMBL6177

PTM databases

iPTMnetiO95544
PhosphoSitePlusiO95544

Polymorphism and mutation databases

BioMutaiNADK

Proteomic databases

EPDiO95544
jPOSTiO95544
MaxQBiO95544
PaxDbiO95544
PeptideAtlasiO95544
PRIDEiO95544
ProteomicsDBi50936

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65220
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341426; ENSP00000341679; ENSG00000008130 [O95544-1]
ENST00000341991; ENSP00000344340; ENSG00000008130 [O95544-1]
ENST00000378625; ENSP00000367890; ENSG00000008130 [O95544-2]
GeneIDi65220
KEGGihsa:65220
UCSCiuc001aic.3 human [O95544-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65220
DisGeNETi65220
EuPathDBiHostDB:ENSG00000008130.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NADK
HGNCiHGNC:29831 NADK
HPAiHPA048909
HPA053368
MIMi611616 gene
neXtProtiNX_O95544
OpenTargetsiENSG00000008130
PharmGKBiPA142671298

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2178 Eukaryota
COG0061 LUCA
GeneTreeiENSGT00390000013792
HOGENOMiHOG000176769
HOVERGENiHBG008249
InParanoidiO95544
KOiK00858
OrthoDBi1263874at2759
PhylomeDBiO95544
TreeFamiTF324076

Enzyme and pathway databases

BioCyciMetaCyc:HS00233-MONOMER
BRENDAi2.7.1.23 2681
ReactomeiR-HSA-196807 Nicotinate metabolism
SABIO-RKiO95544

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NADK human
EvolutionaryTraceiO95544

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NAD%2B_kinase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65220

Protein Ontology

More...
PROi
PR:O95544

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000008130 Expressed in 227 organ(s), highest expression level in vagina
CleanExiHS_NADK
ExpressionAtlasiO95544 baseline and differential
GenevisibleiO95544 HS

Family and domain databases

Gene3Di2.60.200.30, 1 hit
3.40.50.10330, 1 hit
HAMAPiMF_00361 NAD_kinase, 1 hit
InterProiView protein in InterPro
IPR017438 ATP-NAD_kinase_N
IPR017437 ATP-NAD_kinase_PpnK-typ_C
IPR016064 NAD/diacylglycerol_kinase_sf
IPR002504 NADK
PfamiView protein in Pfam
PF01513 NAD_kinase, 1 hit
SUPFAMiSSF111331 SSF111331, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNADK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95544
Secondary accession number(s): A6NNN3
, A8K296, B7Z434, F5GXR5, Q5QPS4, Q9H2P2, Q9H931
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: January 16, 2019
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again