Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (08 May 2019)
Sequence version 3 (16 Jun 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Formin-like protein 1

Gene

FMNL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the control of cell motility and survival of macrophages (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5663220 RHO GTPases Activate Formins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formin-like protein 1
Alternative name(s):
CLL-associated antigen KW-13
Leukocyte formin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FMNL1
Synonyms:C17orf1, C17orf1B, FMNL, FRL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1212 FMNL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604656 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95466

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
752

Open Targets

More...
OpenTargetsi
ENSG00000184922

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28186

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FMNL1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001948902 – 1100Formin-like protein 1Add BLAST1099

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine2 Publications1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei7PhosphoserineCombined sources1
Modified residuei184PhosphoserineCombined sources1
Modified residuei624PhosphoserineCombined sources1
Modified residuei693PhosphoserineCombined sources1
Modified residuei1031PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Myristoylation mediates membrane localization and blebbing.1 Publication

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95466

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95466

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95466

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95466

PeptideAtlas

More...
PeptideAtlasi
O95466

PRoteomics IDEntifications database

More...
PRIDEi
O95466

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50898
50899 [O95466-2]
50900 [O95466-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95466

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95466

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O95466

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184922 Expressed in 190 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95466 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95466 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008129
HPA028288

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAC1, PFN1 and PFN2 (By similarity). Interacts (activated by RAC1) with SRGAP2 (via SH3 domain); regulates the actin filament severing activity of FMNL1.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107208, 74 interactors

Protein interaction database and analysis system

More...
IntActi
O95466, 18 interactors

Molecular INTeraction database

More...
MINTi
O95466

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000329219

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YDHX-ray3.80A/C1-458[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95466

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 468GBD/FH3PROSITE-ProRule annotationAdd BLAST442
Domaini632 – 1023FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1059 – 1090DADPROSITE-ProRule annotationAdd BLAST32

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi459 – 616Pro-richAdd BLAST158

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the N-terminus. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the formin homology family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1923 Eukaryota
ENOG410Y3DT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156292

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95466

Identification of Orthologs from Complete Genome Data

More...
OMAi
RINTLTF

Database of Orthologous Groups

More...
OrthoDBi
288325at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95466

TreeFam database of animal gene trees

More...
TreeFami
TF325155

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027657 FMNL1
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd

The PANTHER Classification System

More...
PANTHERi
PTHR45857:SF2 PTHR45857:SF2, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95466-1) [UniParc]FASTAAdd to basket
Also known as: FMNL1alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAAGSAEQ PAGPAAPPPK QPAPPKQPMP AAGELEERFN RALNCMNLPP
60 70 80 90 100
DKVQLLSQYD NEKKWELICD QERFQVKNPP AAYIQKLKSY VDTGGVSRKV
110 120 130 140 150
AADWMSNLGF KRRVQESTQV LRELETSLRT NHIGWVQEFL NEENRGLDVL
160 170 180 190 200
LEYLAFAQCS VTYDMESTDN GASNSEKNKP LEQSVEDLSK GPPSSVPKSR
210 220 230 240 250
HLTIKLTPAH SRKALRNSRI VSQKDDVHVC IMCLRAIMNY QSGFSLVMNH
260 270 280 290 300
PACVNEIALS LNNKNPRTKA LVLELLAAVC LVRGGHDIIL AAFDNFKEVC
310 320 330 340 350
GEQHRFEKLM EYFRNEDSNI DFMVACMQFI NIVVHSVENM NFRVFLQYEF
360 370 380 390 400
THLGLDLYLE RLRLTESDKL QVQIQAYLDN IFDVGALLED TETKNAVLEH
410 420 430 440 450
MEELQEQVAL LTERLRDAEN ESMAKIAELE KQLSQARKEL ETLRERFSES
460 470 480 490 500
TAMGPSRRPP EPEKAPPAAP TRPSALELKV EELEEKGLIR ILRGPGDAVS
510 520 530 540 550
IEILPVAVAT PSGGDAPTPG VPTGSPSPDL APAAEPAPGA APPPPPPLPG
560 570 580 590 600
LPSPQEAPPS APPQAPPLPG SPEPPPAPPL PGDLPPPPPP PPPPPGTDGP
610 620 630 640 650
VPPPPPPPPP PPGGPPDALG RRDSELGPGV KAKKPIQTKF RMPLLNWVAL
660 670 680 690 700
KPSQITGTVF TELNDEKVLQ ELDMSDFEEQ FKTKSQGPSL DLSALKSKAA
710 720 730 740 750
QKAPSKATLI EANRAKNLAI TLRKGNLGAE RICQAIEAYD LQALGLDFLE
760 770 780 790 800
LLMRFLPTEY ERSLITRFER EQRPMEELSE EDRFMLCFSR IPRLPERMTT
810 820 830 840 850
LTFLGNFPDT AQLLMPQLNA IIAASMSIKS SDKLRQILEI VLAFGNYMNS
860 870 880 890 900
SKRGAAYGFR LQSLDALLEM KSTDRKQTLL HYLVKVIAEK YPQLTGFHSD
910 920 930 940 950
LHFLDKAGSV SLDSVLADVR SLQRGLELTQ REFVRQDDCM VLKEFLRANS
960 970 980 990 1000
PTMDKLLADS KTAQEAFESV VEYFGENPKT TSPGLFFSLF SRFIKAYKKA
1010 1020 1030 1040 1050
EQEVEQWKKE AAAQEAGADT PGKGEPPAPK SPPKARRPQM DLISELKRRQ
1060 1070 1080 1090 1100
QKEPLIYESD RDGAIEDIIT VIKTVPFTAR TGKRTSRLLC EASLGEEMPL
Length:1,100
Mass (Da):121,854
Last modified:June 16, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i91F9CE2B3B526FFC
GO
Isoform 2 (identifier: O95466-2) [UniParc]FASTAAdd to basket
Also known as: FMNL1beta

The sequence of this isoform differs from the canonical sequence as follows:
     1071-1100: VIKTVPFTARTGKRTSRLLCEASLGEEMPL → DLRNQPYIRADTGRRSARRRPPGPPLQVTSDLSL

Show »
Length:1,104
Mass (Da):122,409
Checksum:i74CFC7C3D5ABCC23
GO
Isoform 3 (identifier: O95466-3) [UniParc]FASTAAdd to basket
Also known as: FMNL1gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1070-1070: T → TGKGLARPWSYPQSVLLCFLLTQCAILWGTGCHTASCYLFCFSFLFPFSTPLHLPHPHS

Note: Due to intron retention. Constitutively activated form, probably due to alterations in the DAD domain.
Show »
Length:1,158
Mass (Da):128,335
Checksum:i43D0BA60ABEA6AD5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EK60K7EK60_HUMAN
Formin-like protein 1
FMNL1
682Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJE6K7EJE6_HUMAN
Formin-like protein 1
FMNL1
488Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERL1K7ERL1_HUMAN
Formin-like protein 1
FMNL1
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR62A0A0A0MR62_HUMAN
Formin-like protein 1
FMNL1
626Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMY8K7EMY8_HUMAN
Formin-like protein 1
FMNL1
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH21906 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAA07870 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti455P → A in AAP32476 (Ref. 1) Curated1
Sequence conflicti455P → A in AAL99920 (Ref. 3) Curated1
Sequence conflicti455P → A in AAH73988 (PubMed:15489334).Curated1
Sequence conflicti602Missing in AAH21906 (PubMed:15489334).Curated1
Sequence conflicti629G → R in CAA07870 (PubMed:9799091).Curated1
Isoform 2 (identifier: O95466-2)
Sequence conflicti1101 – 1102DL → EV in AAH21906 (PubMed:15489334).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438451070T → TGKGLARPWSYPQSVLLCFL LTQCAILWGTGCHTASCYLF CFSFLFPFSTPLHLPHPHS in isoform 3. 1 Publication1
Alternative sequenceiVSP_0139771071 – 1100VIKTV…EEMPL → DLRNQPYIRADTGRRSARRR PPGPPLQVTSDLSL in isoform 2. 3 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY278319 mRNA Translation: AAP32476.1
AC008105 mRNA No translation available.
AF432213 mRNA Translation: AAL99920.1
BC001710 mRNA Translation: AAH01710.2
BC009000 mRNA Translation: AAH09000.2
BC021906 mRNA Translation: AAH21906.1 Different initiation.
BC073988 mRNA Translation: AAH73988.1
AJ008112 mRNA Translation: CAA07870.1 Different initiation.
CR456759 mRNA Translation: CAG33040.1
FJ534522 mRNA Translation: ACR19333.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11497.1 [O95466-1]

NCBI Reference Sequences

More...
RefSeqi
NP_005883.2, NM_005892.3 [O95466-1]
XP_006722126.1, XM_006722063.3 [O95466-3]
XP_006722133.1, XM_006722070.3 [O95466-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000331495; ENSP00000329219; ENSG00000184922 [O95466-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
752

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:752

UCSC genome browser

More...
UCSCi
uc002iin.4 human [O95466-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY278319 mRNA Translation: AAP32476.1
AC008105 mRNA No translation available.
AF432213 mRNA Translation: AAL99920.1
BC001710 mRNA Translation: AAH01710.2
BC009000 mRNA Translation: AAH09000.2
BC021906 mRNA Translation: AAH21906.1 Different initiation.
BC073988 mRNA Translation: AAH73988.1
AJ008112 mRNA Translation: CAA07870.1 Different initiation.
CR456759 mRNA Translation: CAG33040.1
FJ534522 mRNA Translation: ACR19333.1
CCDSiCCDS11497.1 [O95466-1]
RefSeqiNP_005883.2, NM_005892.3 [O95466-1]
XP_006722126.1, XM_006722063.3 [O95466-3]
XP_006722133.1, XM_006722070.3 [O95466-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YDHX-ray3.80A/C1-458[»]
SMRiO95466
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107208, 74 interactors
IntActiO95466, 18 interactors
MINTiO95466
STRINGi9606.ENSP00000329219

PTM databases

iPTMnetiO95466
PhosphoSitePlusiO95466
SwissPalmiO95466

Polymorphism and mutation databases

BioMutaiFMNL1

Proteomic databases

EPDiO95466
jPOSTiO95466
MaxQBiO95466
PaxDbiO95466
PeptideAtlasiO95466
PRIDEiO95466
ProteomicsDBi50898
50899 [O95466-2]
50900 [O95466-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331495; ENSP00000329219; ENSG00000184922 [O95466-1]
GeneIDi752
KEGGihsa:752
UCSCiuc002iin.4 human [O95466-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
752
DisGeNETi752

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FMNL1
HGNCiHGNC:1212 FMNL1
HPAiHPA008129
HPA028288
MIMi604656 gene
neXtProtiNX_O95466
OpenTargetsiENSG00000184922
PharmGKBiPA28186

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00940000156292
InParanoidiO95466
OMAiRINTLTF
OrthoDBi288325at2759
PhylomeDBiO95466
TreeFamiTF325155

Enzyme and pathway databases

ReactomeiR-HSA-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FMNL1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FMNL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
752

Protein Ontology

More...
PROi
PR:O95466

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184922 Expressed in 190 organ(s), highest expression level in blood
ExpressionAtlasiO95466 baseline and differential
GenevisibleiO95466 HS

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027657 FMNL1
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR45857:SF2 PTHR45857:SF2, 2 hits
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFMNL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95466
Secondary accession number(s): D2DGW2
, Q6DKG5, Q6IBP3, Q86UH1, Q8N671, Q8TDH1, Q96H10
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: June 16, 2009
Last modified: May 8, 2019
This is version 170 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again