Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urotensin-2

Gene

UTS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Highly potent vasoconstrictor.

GO - Molecular functioni

  • hormone activity Source: ProtInc
  • signaling receptor binding Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionHormone

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Urotensin-2
Alternative name(s):
Urotensin II
Short name:
U-II
Short name:
UII
Gene namesi
Name:UTS2
ORF Names:UNQ525/PRO1068
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000049247.13
HGNCiHGNC:12636 UTS2
MIMi604097 gene
neXtProtiNX_O95399

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi10911
OpenTargetsiENSG00000049247
PharmGKBiPA37261

Polymorphism and mutation databases

BioMutaiUTS2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
PropeptideiPRO_000003634621 – 110Add BLAST90
PeptideiPRO_0000036347114 – 124Urotensin-2Add BLAST11

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi118 ↔ 123By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

EPDiO95399
MaxQBiO95399
PeptideAtlasiO95399
PRIDEiO95399
ProteomicsDBi50851
50852 [O95399-2]

Expressioni

Tissue specificityi

Brain specific.

Gene expression databases

BgeeiENSG00000049247 Expressed in 91 organ(s), highest expression level in adrenal tissue
CleanExiHS_UTS2
ExpressionAtlasiO95399 baseline and differential
GenevisibleiO95399 HS

Organism-specific databases

HPAiHPA017000

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116116, 2 interactors
IntActiO95399, 2 interactors

Chemistry databases

BindingDBiO95399

Structurei

3D structure databases

ProteinModelPortaliO95399
SMRiO95399
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urotensin-2 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00510000049583
HOGENOMiHOG000136847
HOVERGENiHBG065793
InParanoidiO95399
KOiK05248
OMAiRKFQAFS
OrthoDBiEOG091G12LI
PhylomeDBiO95399
TreeFamiTF330799

Family and domain databases

InterProiView protein in InterPro
IPR001483 Urotensin_II
PfamiView protein in Pfam
PF02083 Urotensin_II, 1 hit
PROSITEiView protein in PROSITE
PS00984 UROTENSIN_II, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95399-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYKLASCCLL FIGFLNPLLS LPLLDSREIS FQLSAPHEDA RLTPEELERA
60 70 80 90 100
SLLQILPEML GAERGDILRK ADSSTNIFNP RGNLRKFQDF SGQDPNILLS
110 120
HLLARIWKPY KKRETPDCFW KYCV
Length:124
Mass (Da):14,296
Last modified:May 1, 1999 - v1
Checksum:iC7A5FC7EFE00D312
GO
Isoform 2 (identifier: O95399-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MYKLASCCLLFIGFLNPLLSLPLLDSR → METNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLL

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):16,029
Checksum:i8E8FFEF916A105BD
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5H8X8Q5H8X8_HUMAN
Urotensin-2
UTS2
139Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05373412I → T1 PublicationCorresponds to variant dbSNP:rs34305100Ensembl.1
Natural variantiVAR_02931374S → N. Corresponds to variant dbSNP:rs2890565Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0136381 – 27MYKLA…LLDSR → METNVFHLMLCVTSARTHKS TSLCFGHFNSYPSLPLIHDL LL in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104118 mRNA Translation: AAD13070.1
AF140630 mRNA Translation: AAD55577.1
AY358375 mRNA Translation: AAQ88741.1
Z98884 Genomic DNA No translation available.
CCDSiCCDS90.1 [O95399-2]
CCDS91.1 [O95399-1]
RefSeqiNP_006777.1, NM_006786.3 [O95399-1]
NP_068835.1, NM_021995.2 [O95399-2]
XP_011538839.1, XM_011540537.2 [O95399-2]
XP_011538840.1, XM_011540538.1 [O95399-1]
UniGeneiHs.715862

Genome annotation databases

EnsembliENST00000054668; ENSP00000054668; ENSG00000049247 [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247 [O95399-1]
GeneIDi10911
KEGGihsa:10911
UCSCiuc001aor.4 human [O95399-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF104118 mRNA Translation: AAD13070.1
AF140630 mRNA Translation: AAD55577.1
AY358375 mRNA Translation: AAQ88741.1
Z98884 Genomic DNA No translation available.
CCDSiCCDS90.1 [O95399-2]
CCDS91.1 [O95399-1]
RefSeqiNP_006777.1, NM_006786.3 [O95399-1]
NP_068835.1, NM_021995.2 [O95399-2]
XP_011538839.1, XM_011540537.2 [O95399-2]
XP_011538840.1, XM_011540538.1 [O95399-1]
UniGeneiHs.715862

3D structure databases

ProteinModelPortaliO95399
SMRiO95399
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116116, 2 interactors
IntActiO95399, 2 interactors

Chemistry databases

BindingDBiO95399

Polymorphism and mutation databases

BioMutaiUTS2

Proteomic databases

EPDiO95399
MaxQBiO95399
PeptideAtlasiO95399
PRIDEiO95399
ProteomicsDBi50851
50852 [O95399-2]

Protocols and materials databases

DNASUi10911
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000054668; ENSP00000054668; ENSG00000049247 [O95399-2]
ENST00000361696; ENSP00000355163; ENSG00000049247 [O95399-1]
GeneIDi10911
KEGGihsa:10911
UCSCiuc001aor.4 human [O95399-1]

Organism-specific databases

CTDi10911
DisGeNETi10911
EuPathDBiHostDB:ENSG00000049247.13
GeneCardsiUTS2
HGNCiHGNC:12636 UTS2
HPAiHPA017000
MIMi604097 gene
neXtProtiNX_O95399
OpenTargetsiENSG00000049247
PharmGKBiPA37261
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00510000049583
HOGENOMiHOG000136847
HOVERGENiHBG065793
InParanoidiO95399
KOiK05248
OMAiRKFQAFS
OrthoDBiEOG091G12LI
PhylomeDBiO95399
TreeFamiTF330799

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events

Miscellaneous databases

ChiTaRSiUTS2 human
GeneWikiiUTS2
GenomeRNAii10911
PROiPR:O95399
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000049247 Expressed in 91 organ(s), highest expression level in adrenal tissue
CleanExiHS_UTS2
ExpressionAtlasiO95399 baseline and differential
GenevisibleiO95399 HS

Family and domain databases

InterProiView protein in InterPro
IPR001483 Urotensin_II
PfamiView protein in Pfam
PF02083 Urotensin_II, 1 hit
PROSITEiView protein in PROSITE
PS00984 UROTENSIN_II, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUTS2_HUMAN
AccessioniPrimary (citable) accession number: O95399
Secondary accession number(s): Q5H8X7, Q6UXF6, Q9UKP7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 146 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again