Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WNT1-inducible-signaling pathway protein 1

Gene

WISP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • heparin binding Source: GO_Central
  • insulin-like growth factor binding Source: InterPro
  • integrin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion, Wnt signaling pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WNT1-inducible-signaling pathway protein 1
Short name:
WISP-1
Alternative name(s):
CCN family member 4
Wnt-1-induced secreted protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WISP1
Synonyms:CCN4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000104415.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12769 WISP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603398 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95388

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
8840

Open Targets

More...
OpenTargetsi
ENSG00000104415

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37372

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WISP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001440623 – 367WNT1-inducible-signaling pathway protein 1Add BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi273 ↔ 310By similarity
Glycosylationi284N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi290 ↔ 324By similarity
Disulfide bondi301 ↔ 340By similarity
Disulfide bondi304 ↔ 342By similarity
Disulfide bondi309 ↔ 346By similarity
Glycosylationi343N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95388

PeptideAtlas

More...
PeptideAtlasi
O95388

PRoteomics IDEntifications database

More...
PRIDEi
O95388

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50837
50838 [O95388-2]
50839 [O95388-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95388

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95388

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000104415 Expressed in 124 organ(s), highest expression level in metanephros

CleanEx database of gene expression profiles

More...
CleanExi
HS_WISP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95388 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95388 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB012205
HPA007121

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114367, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O95388, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000250160

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95388

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95388

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 118IGFBP N-terminalPROSITE-ProRule annotationAdd BLAST79
Domaini121 – 186VWFCPROSITE-ProRule annotationAdd BLAST66
Domaini215 – 260TSP type-1PROSITE-ProRule annotationAdd BLAST46
Domaini273 – 347CTCKPROSITE-ProRule annotationAdd BLAST75

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCN family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IH8M Eukaryota
ENOG410ZWR5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158587

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231462

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000635

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95388

KEGG Orthology (KO)

More...
KOi
K22471

Identification of Orthologs from Complete Genome Data

More...
OMAi
GEVEPWH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0SQP

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95388

TreeFam database of animal gene trees

More...
TreeFami
TF326070

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.20.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006207 Cys_knot_C
IPR006208 Glyco_hormone_CN
IPR009030 Growth_fac_rcpt_cys_sf
IPR000867 IGFBP-like
IPR012395 IGFBP_CNN
IPR017891 Insulin_GF-bd_Cys-rich_CS
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR001007 VWF_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00007 Cys_knot, 1 hit
PF00219 IGFBP, 1 hit
PF00090 TSP_1, 1 hit
PF00093 VWC, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF036495 IGFBP_rP_CNN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00041 CT, 1 hit
SM00121 IB, 1 hit
SM00209 TSP1, 1 hit
SM00214 VWC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57184 SSF57184, 1 hit
SSF82895 SSF82895, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01185 CTCK_1, 1 hit
PS01225 CTCK_2, 1 hit
PS00222 IGFBP_N_1, 1 hit
PS51323 IGFBP_N_2, 1 hit
PS50092 TSP1, 1 hit
PS01208 VWFC_1, 1 hit
PS50184 VWFC_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95388-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK
60 70 80 90 100
WPCECPPSPP RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY
110 120 130 140 150
CDYSGDRPRY AIGVCAQVVG VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA
160 170 180 190 200
VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC EQWVCEDDAK RPRKTAPRDT
210 220 230 240 250
GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN VNAQCWPEQE
260 270 280 290 300
SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY
310 320 330 340 350
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN
360
DIFADLESYP DFSEIAN
Length:367
Mass (Da):40,331
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9F29CA94D69C0502
GO
Isoform 2 (identifier: O95388-2) [UniParc]FASTAAdd to basket
Also known as: WISP1v

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: Q → H
     118-204: Missing.

Show »
Length:280
Mass (Da):30,697
Checksum:i26B254D4A060738E
GO
Isoform 3 (identifier: O95388-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-268: Missing.

Show »
Length:122
Mass (Da):13,490
Checksum:iBFFABA376CB30BE8
GO
Isoform 4 (identifier: O95388-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
     156-367: Missing.

Show »
Length:155
Mass (Da):16,802
Checksum:i68B64C21B83E7E40
GO
Isoform 5 (identifier: O95388-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
     32-203: Missing.

Show »
Length:195
Mass (Da):21,550
Checksum:i09116547C1D5E824
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RG88E5RG88_HUMAN
Cellular communication network fact...
CCN4
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti91A → V in AAP43926 (Ref. 3) Curated1
Isoform 4 (identifier: O95388-4)
Sequence conflicti155Q → QQVLHPLQV in AAP43926 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061265205A → S. Corresponds to variant dbSNP:rs35513885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0477061 – 31MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_04201024 – 268Missing in isoform 3. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_04770732 – 203Missing in isoform 5. 2 PublicationsAdd BLAST172
Alternative sequenceiVSP_045958117 – 155QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_008008117Q → H in isoform 2. 1 Publication1
Alternative sequenceiVSP_008009118 – 204Missing in isoform 2. 1 PublicationAdd BLAST87
Alternative sequenceiVSP_045959156 – 367Missing in isoform 4. 1 PublicationAdd BLAST212

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF100779 mRNA Translation: AAC96321.1
AB034725 mRNA Translation: BAB17849.1
AY196486 mRNA Translation: AAP43924.1
AY196487 mRNA Translation: AAP43925.1
AY196488 mRNA Translation: AAP43926.1
AK293031 mRNA Translation: BAF85720.1
AK301508 mRNA Translation: BAG63017.1
AF192304 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW92162.1
BC074840 mRNA Translation: AAH74840.1
BC074841 mRNA Translation: AAH74841.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56555.1 [O95388-4]
CCDS56556.1 [O95388-3]
CCDS6371.1 [O95388-1]
CCDS6372.1 [O95388-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001191798.1, NM_001204869.1 [O95388-4]
NP_001191799.1, NM_001204870.1 [O95388-3]
NP_003873.1, NM_003882.3 [O95388-1]
NP_543028.1, NM_080838.2 [O95388-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.492974

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000220856; ENSP00000220856; ENSG00000104415 [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415 [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415 [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415 [O95388-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8840

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8840

UCSC genome browser

More...
UCSCi
uc003yub.4 human [O95388-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA Translation: AAC96321.1
AB034725 mRNA Translation: BAB17849.1
AY196486 mRNA Translation: AAP43924.1
AY196487 mRNA Translation: AAP43925.1
AY196488 mRNA Translation: AAP43926.1
AK293031 mRNA Translation: BAF85720.1
AK301508 mRNA Translation: BAG63017.1
AF192304 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW92162.1
BC074840 mRNA Translation: AAH74840.1
BC074841 mRNA Translation: AAH74841.1
CCDSiCCDS56555.1 [O95388-4]
CCDS56556.1 [O95388-3]
CCDS6371.1 [O95388-1]
CCDS6372.1 [O95388-2]
RefSeqiNP_001191798.1, NM_001204869.1 [O95388-4]
NP_001191799.1, NM_001204870.1 [O95388-3]
NP_003873.1, NM_003882.3 [O95388-1]
NP_543028.1, NM_080838.2 [O95388-2]
UniGeneiHs.492974

3D structure databases

ProteinModelPortaliO95388
SMRiO95388
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114367, 1 interactor
IntActiO95388, 3 interactors
STRINGi9606.ENSP00000250160

PTM databases

iPTMnetiO95388
PhosphoSitePlusiO95388

Polymorphism and mutation databases

BioMutaiWISP1

Proteomic databases

PaxDbiO95388
PeptideAtlasiO95388
PRIDEiO95388
ProteomicsDBi50837
50838 [O95388-2]
50839 [O95388-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8840
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220856; ENSP00000220856; ENSG00000104415 [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415 [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415 [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415 [O95388-3]
GeneIDi8840
KEGGihsa:8840
UCSCiuc003yub.4 human [O95388-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8840
DisGeNETi8840
EuPathDBiHostDB:ENSG00000104415.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WISP1
HGNCiHGNC:12769 WISP1
HPAiCAB012205
HPA007121
MIMi603398 gene
neXtProtiNX_O95388
OpenTargetsiENSG00000104415
PharmGKBiPA37372

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IH8M Eukaryota
ENOG410ZWR5 LUCA
GeneTreeiENSGT00940000158587
HOGENOMiHOG000231462
HOVERGENiHBG000635
InParanoidiO95388
KOiK22471
OMAiGEVEPWH
OrthoDBiEOG091G0SQP
PhylomeDBiO95388
TreeFamiTF326070

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WISP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
WNT1-inducible-signaling_pathway_protein_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8840

Protein Ontology

More...
PROi
PR:O95388

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000104415 Expressed in 124 organ(s), highest expression level in metanephros
CleanExiHS_WISP1
ExpressionAtlasiO95388 baseline and differential
GenevisibleiO95388 HS

Family and domain databases

Gene3Di2.20.100.10, 1 hit
InterProiView protein in InterPro
IPR006207 Cys_knot_C
IPR006208 Glyco_hormone_CN
IPR009030 Growth_fac_rcpt_cys_sf
IPR000867 IGFBP-like
IPR012395 IGFBP_CNN
IPR017891 Insulin_GF-bd_Cys-rich_CS
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR001007 VWF_dom
PfamiView protein in Pfam
PF00007 Cys_knot, 1 hit
PF00219 IGFBP, 1 hit
PF00090 TSP_1, 1 hit
PF00093 VWC, 1 hit
PIRSFiPIRSF036495 IGFBP_rP_CNN, 1 hit
SMARTiView protein in SMART
SM00041 CT, 1 hit
SM00121 IB, 1 hit
SM00209 TSP1, 1 hit
SM00214 VWC, 1 hit
SUPFAMiSSF57184 SSF57184, 1 hit
SSF82895 SSF82895, 1 hit
PROSITEiView protein in PROSITE
PS01185 CTCK_1, 1 hit
PS01225 CTCK_2, 1 hit
PS00222 IGFBP_N_1, 1 hit
PS51323 IGFBP_N_2, 1 hit
PS50092 TSP1, 1 hit
PS01208 VWFC_1, 1 hit
PS50184 VWFC_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWISP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95388
Secondary accession number(s): A8KAG6
, E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: May 1, 1999
Last modified: December 5, 2018
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again