Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WNT1-inducible-signaling pathway protein 1

Gene

WISP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Downstream regulator in the Wnt/Frizzled-signaling pathway. Associated with cell survival. Attenuates p53-mediated apoptosis in response to DNA damage through activation of AKT kinase. Up-regulates the anti-apoptotic Bcl-X(L) protein. Adheres to skin and melanoma fibroblasts. In vitro binding to skin fibroblasts occurs through the proteoglycans, decorin and biglycan.2 Publications

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • cell-cell signaling Source: ProtInc
  • negative regulation of cell death Source: GO_Central
  • regulation of cell growth Source: InterPro
  • signal transduction Source: ProtInc
  • Wnt signaling pathway Source: UniProtKB-KW

Keywordsi

Biological processCell adhesion, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
WNT1-inducible-signaling pathway protein 1
Short name:
WISP-1
Alternative name(s):
CCN family member 4
Wnt-1-induced secreted protein
Gene namesi
Name:WISP1
Synonyms:CCN4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000104415.13
HGNCiHGNC:12769 WISP1
MIMi603398 gene
neXtProtiNX_O95388

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi8840
OpenTargetsiENSG00000104415
PharmGKBiPA37372

Polymorphism and mutation databases

BioMutaiWISP1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001440623 – 367WNT1-inducible-signaling pathway protein 1Add BLAST345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi273 ↔ 310By similarity
Glycosylationi284N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi290 ↔ 324By similarity
Disulfide bondi301 ↔ 340By similarity
Disulfide bondi304 ↔ 342By similarity
Disulfide bondi309 ↔ 346By similarity
Glycosylationi343N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO95388
PeptideAtlasiO95388
PRIDEiO95388
ProteomicsDBi50837
50838 [O95388-2]
50839 [O95388-3]

PTM databases

iPTMnetiO95388
PhosphoSitePlusiO95388

Expressioni

Tissue specificityi

Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers including breast cancer and colon tumors. Isoform 2 is overexpressed in scirrhous gastric carcinoma.

Gene expression databases

BgeeiENSG00000104415
CleanExiHS_WISP1
ExpressionAtlasiO95388 baseline and differential
GenevisibleiO95388 HS

Organism-specific databases

HPAiCAB012205
HPA007121

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114367, 1 interactor
IntActiO95388, 4 interactors
STRINGi9606.ENSP00000250160

Structurei

3D structure databases

ProteinModelPortaliO95388
SMRiO95388
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 118IGFBP N-terminalPROSITE-ProRule annotationAdd BLAST79
Domaini121 – 186VWFCPROSITE-ProRule annotationAdd BLAST66
Domaini215 – 260TSP type-1PROSITE-ProRule annotationAdd BLAST46
Domaini273 – 347CTCKPROSITE-ProRule annotationAdd BLAST75

Sequence similaritiesi

Belongs to the CCN family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IH8M Eukaryota
ENOG410ZWR5 LUCA
GeneTreeiENSGT00760000119225
HOGENOMiHOG000231462
HOVERGENiHBG000635
InParanoidiO95388
KOiK22471
OMAiGEVEPWH
OrthoDBiEOG091G0SQP
PhylomeDBiO95388
TreeFamiTF326070

Family and domain databases

Gene3Di2.20.100.10, 1 hit
InterProiView protein in InterPro
IPR006207 Cys_knot_C
IPR006208 Glyco_hormone_CN
IPR009030 Growth_fac_rcpt_cys_sf
IPR000867 IGFBP-like
IPR012395 IGFBP_CNN
IPR017891 Insulin_GF-bd_Cys-rich_CS
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR001007 VWF_dom
PfamiView protein in Pfam
PF00007 Cys_knot, 1 hit
PF00219 IGFBP, 1 hit
PF00090 TSP_1, 1 hit
PF00093 VWC, 1 hit
PIRSFiPIRSF036495 IGFBP_rP_CNN, 1 hit
SMARTiView protein in SMART
SM00041 CT, 1 hit
SM00121 IB, 1 hit
SM00209 TSP1, 1 hit
SM00214 VWC, 1 hit
SUPFAMiSSF57184 SSF57184, 1 hit
SSF82895 SSF82895, 1 hit
PROSITEiView protein in PROSITE
PS01185 CTCK_1, 1 hit
PS01225 CTCK_2, 1 hit
PS00222 IGFBP_N_1, 1 hit
PS51323 IGFBP_N_2, 1 hit
PS50092 TSP1, 1 hit
PS01208 VWFC_1, 1 hit
PS50184 VWFC_2, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95388-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRWFLPWTLA AVTAAAASTV LATALSPAPT TMDFTPAPLE DTSSRPQFCK
60 70 80 90 100
WPCECPPSPP RCPLGVSLIT DGCECCKMCA QQLGDNCTEA AICDPHRGLY
110 120 130 140 150
CDYSGDRPRY AIGVCAQVVG VGCVLDGVRY NNGQSFQPNC KYNCTCIDGA
160 170 180 190 200
VGCTPLCLRV RPPRLWCPHP RRVSIPGHCC EQWVCEDDAK RPRKTAPRDT
210 220 230 240 250
GAFDAVGEVE AWHRNCIAYT SPWSPCSTSC GLGVSTRISN VNAQCWPEQE
260 270 280 290 300
SRLCNLRPCD VDIHTLIKAG KKCLAVYQPE ASMNFTLAGC ISTRSYQPKY
310 320 330 340 350
CGVCMDNRCC IPYKSKTIDV SFQCPDGLGF SRQVLWINAC FCNLSCRNPN
360
DIFADLESYP DFSEIAN
Length:367
Mass (Da):40,331
Last modified:May 1, 1999 - v1
Checksum:i9F29CA94D69C0502
GO
Isoform 2 (identifier: O95388-2) [UniParc]FASTAAdd to basket
Also known as: WISP1v

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: Q → H
     118-204: Missing.

Show »
Length:280
Mass (Da):30,697
Checksum:i26B254D4A060738E
GO
Isoform 3 (identifier: O95388-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-268: Missing.

Show »
Length:122
Mass (Da):13,490
Checksum:iBFFABA376CB30BE8
GO
Isoform 4 (identifier: O95388-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-155: QVVGVGCVLD...CIDGAVGCTP → RREEVSGCVP...TQVLWSLHGQ
     156-367: Missing.

Show »
Length:155
Mass (Da):16,802
Checksum:i68B64C21B83E7E40
GO
Isoform 5 (identifier: O95388-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MRWFLPWTLAAVTAAAASTVLATALSPAPTT → MPVPLTSRHEVVPALDAGSSDSSSRQHRPGH
     32-203: Missing.

Show »
Length:195
Mass (Da):21,550
Checksum:i09116547C1D5E824
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti91A → V in AAP43926 (Ref. 3) Curated1
Isoform 4 (identifier: O95388-4)
Sequence conflicti155Q → QQVLHPLQV in AAP43926 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061265205A → S. Corresponds to variant dbSNP:rs35513885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0477061 – 31MRWFL…PAPTT → MPVPLTSRHEVVPALDAGSS DSSSRQHRPGH in isoform 5. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_04201024 – 268Missing in isoform 3. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_04770732 – 203Missing in isoform 5. 2 PublicationsAdd BLAST172
Alternative sequenceiVSP_045958117 – 155QVVGV…VGCTP → RREEVSGCVPARGIHELHTC GLHQHTLLSTQVLWSLHGQ in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_008008117Q → H in isoform 2. 1 Publication1
Alternative sequenceiVSP_008009118 – 204Missing in isoform 2. 1 PublicationAdd BLAST87
Alternative sequenceiVSP_045959156 – 367Missing in isoform 4. 1 PublicationAdd BLAST212

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100779 mRNA Translation: AAC96321.1
AB034725 mRNA Translation: BAB17849.1
AY196486 mRNA Translation: AAP43924.1
AY196487 mRNA Translation: AAP43925.1
AY196488 mRNA Translation: AAP43926.1
AK293031 mRNA Translation: BAF85720.1
AK301508 mRNA Translation: BAG63017.1
AF192304 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW92162.1
BC074840 mRNA Translation: AAH74840.1
BC074841 mRNA Translation: AAH74841.1
CCDSiCCDS56555.1 [O95388-4]
CCDS56556.1 [O95388-3]
CCDS6371.1 [O95388-1]
CCDS6372.1 [O95388-2]
RefSeqiNP_001191798.1, NM_001204869.1 [O95388-4]
NP_001191799.1, NM_001204870.1 [O95388-3]
NP_003873.1, NM_003882.3 [O95388-1]
NP_543028.1, NM_080838.2 [O95388-2]
UniGeneiHs.492974

Genome annotation databases

EnsembliENST00000220856; ENSP00000220856; ENSG00000104415 [O95388-2]
ENST00000250160; ENSP00000250160; ENSG00000104415 [O95388-1]
ENST00000517423; ENSP00000427744; ENSG00000104415 [O95388-4]
ENST00000519433; ENSP00000429185; ENSG00000104415 [O95388-3]
GeneIDi8840
KEGGihsa:8840
UCSCiuc003yub.4 human [O95388-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWISP1_HUMAN
AccessioniPrimary (citable) accession number: O95388
Secondary accession number(s): A8KAG6
, E7EMM5, Q5JBS6, Q5JBS7, Q5JBS8, Q9HCS3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: May 1, 1999
Last modified: July 18, 2018
This is version 159 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health