Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase FKBP9

Gene

FKBP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

PPIases accelerate the folding of proteins during protein synthesis.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by FK506.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi501 – 5131PROSITE-ProRule annotationAdd BLAST13
Calcium bindingi546 – 5572PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase, Rotamase
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase FKBP9 (EC:5.2.1.8)
Short name:
PPIase FKBP9
Alternative name(s):
63 kDa FK506-binding protein
Short name:
63 kDa FKBP
Short name:
FKBP-63
FK506-binding protein 9
Short name:
FKBP-9
Rotamase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FKBP9
Synonyms:FKBP60, FKBP63
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000122642.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3725 FKBP9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616257 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95302

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000122642

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28166

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FKBP9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004576025 – 570Peptidyl-prolyl cis-trans isomerase FKBP9Add BLAST546

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi174N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi286N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi302N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi397N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95302

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95302

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95302

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95302

PeptideAtlas

More...
PeptideAtlasi
O95302

PRoteomics IDEntifications database

More...
PRIDEi
O95302

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50800

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1598

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95302

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95302

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000122642 Expressed in 99 organ(s), highest expression level in adipose tissue

CleanEx database of gene expression profiles

More...
CleanExi
HS_FKBP9

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95302 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95302 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA012595
HPA055256

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116456, 39 interactors

Protein interaction database and analysis system

More...
IntActi
O95302, 4 interactors

Molecular INTeraction database

More...
MINTi
O95302

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000242209

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95302

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95302

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini54 – 142PPIase FKBP-type 1PROSITE-ProRule annotationAdd BLAST89
Domaini166 – 254PPIase FKBP-type 2PROSITE-ProRule annotationAdd BLAST89
Domaini278 – 365PPIase FKBP-type 3PROSITE-ProRule annotationAdd BLAST88
Domaini389 – 477PPIase FKBP-type 4PROSITE-ProRule annotationAdd BLAST89
Domaini488 – 523EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini533 – 568EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi567 – 570Prevents secretion from ERPROSITE-ProRule annotation4

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0549 Eukaryota
COG0545 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157125

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051620

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95302

KEGG Orthology (KO)

More...
KOi
K09575

Identification of Orthologs from Complete Genome Data

More...
OMAi
EMIVKNM

Database of Orthologous Groups

More...
OrthoDBi
1507309at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95302

TreeFam database of animal gene trees

More...
TreeFami
TF105296

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00051 EFh, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10516 PTHR10516, 7 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00254 FKBP_C, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00054 EFh, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS00014 ER_TARGET, 1 hit
PS50059 FKBP_PPIASE, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95302-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFRGWRPPP PPLLLLLLWV TGQAAPVAGL GSDAELQIER RFVPDECPRT
60 70 80 90 100
VRSGDFVRYH YVGTFPDGQK FDSSYDRDST FNVFVGKGQL ITGMDQALVG
110 120 130 140 150
MCVNERRFVK IPPKLAYGNE GVSGVIPPNS VLHFDVLLMD IWNSEDQVQI
160 170 180 190 200
HTYFKPPSCP RTIQVSDFVR YHYNGTFLDG TLFDSSHNRM KTYDTYVGIG
210 220 230 240 250
WLIPGMDKGL LGMCVGEKRI ITIPPFLAYG EDGDGKDIPG QASLVFDVAL
260 270 280 290 300
LDLHNPKDSI SIENKVVPEN CERISQSGDF LRYHYNGTLL DGTLFDSSYS
310 320 330 340 350
RNRTFDTYIG QGYVIPGMDE GLLGVCIGEK RRIVVPPHLG YGEEGRGNIP
360 370 380 390 400
GSAVLVFDIH VIDFHNPSDS ISITSHYKPP DCSVLSKKGD YLKYHYNASL
410 420 430 440 450
LDGTLLDSTW NLGKTYNIVL GSGQVVLGMD MGLREMCVGE KRTVIIPPHL
460 470 480 490 500
GYGEAGVDGE VPGSAVLVFD IELLELVAGL PEGYMFIWNG EVSPNLFEEI
510 520 530 540 550
DKDGNGEVLL EEFSEYIHAQ VASGKGKLAP GFDAELIVKN MFTNQDRNGD
560 570
GKVTAEEFKL KDQEAKHDEL
Length:570
Mass (Da):63,084
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE1F44A2FA6E112F8
GO
Isoform 2 (identifier: O95302-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-234: MAFRGWRPPP...PFLAYGEDGD → MA

Show »
Length:338
Mass (Da):37,047
Checksum:i2DAFD52806381800
GO
Isoform 3 (identifier: O95302-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-73: S → SRYWDTAEDKADKSPCPQVRVGVNTSPSCRLKQKGVGIYWKDLQFLVRVQNHGL

Show »
Length:623
Mass (Da):69,155
Checksum:i85E8B433A3631692
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4P8C9J4P8_HUMAN
Peptidylprolyl isomerase
FKBP9
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0548251 – 234MAFRG…GEDGD → MA in isoform 2. 1 PublicationAdd BLAST234
Alternative sequenceiVSP_05482673S → SRYWDTAEDKADKSPCPQVR VGVNTSPSCRLKQKGVGIYW KDLQFLVRVQNHGL in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK128597 mRNA Translation: BAG54697.1
AK293440 mRNA Translation: BAH11505.1
AK300328 mRNA Translation: BAH13259.1
AC083863 Genomic DNA No translation available.
BC007443 mRNA Translation: AAH07443.2
BC064418 mRNA Translation: AAH64418.1
BC072422 mRNA Translation: AAH72422.1
BC101723 mRNA Translation: AAI01724.1
BC112053 mRNA Translation: AAI12054.1
AF089745 mRNA Translation: AAC78853.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5439.1 [O95302-1]
CCDS64622.1 [O95302-3]
CCDS64623.1 [O95302-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001271270.1, NM_001284341.1 [O95302-3]
NP_001271272.1, NM_001284343.1 [O95302-2]
NP_009201.2, NM_007270.4 [O95302-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.103934

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000242209; ENSP00000242209; ENSG00000122642 [O95302-1]
ENST00000490776; ENSP00000441317; ENSG00000122642 [O95302-2]
ENST00000538336; ENSP00000439250; ENSG00000122642 [O95302-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11328

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11328

UCSC genome browser

More...
UCSCi
uc003tdh.5 human [O95302-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128597 mRNA Translation: BAG54697.1
AK293440 mRNA Translation: BAH11505.1
AK300328 mRNA Translation: BAH13259.1
AC083863 Genomic DNA No translation available.
BC007443 mRNA Translation: AAH07443.2
BC064418 mRNA Translation: AAH64418.1
BC072422 mRNA Translation: AAH72422.1
BC101723 mRNA Translation: AAI01724.1
BC112053 mRNA Translation: AAI12054.1
AF089745 mRNA Translation: AAC78853.1
CCDSiCCDS5439.1 [O95302-1]
CCDS64622.1 [O95302-3]
CCDS64623.1 [O95302-2]
RefSeqiNP_001271270.1, NM_001284341.1 [O95302-3]
NP_001271272.1, NM_001284343.1 [O95302-2]
NP_009201.2, NM_007270.4 [O95302-1]
UniGeneiHs.103934

3D structure databases

ProteinModelPortaliO95302
SMRiO95302
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116456, 39 interactors
IntActiO95302, 4 interactors
MINTiO95302
STRINGi9606.ENSP00000242209

PTM databases

GlyConnecti1598
iPTMnetiO95302
PhosphoSitePlusiO95302

Polymorphism and mutation databases

BioMutaiFKBP9

Proteomic databases

EPDiO95302
jPOSTiO95302
MaxQBiO95302
PaxDbiO95302
PeptideAtlasiO95302
PRIDEiO95302
ProteomicsDBi50800

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000242209; ENSP00000242209; ENSG00000122642 [O95302-1]
ENST00000490776; ENSP00000441317; ENSG00000122642 [O95302-2]
ENST00000538336; ENSP00000439250; ENSG00000122642 [O95302-3]
GeneIDi11328
KEGGihsa:11328
UCSCiuc003tdh.5 human [O95302-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11328
EuPathDBiHostDB:ENSG00000122642.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FKBP9

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0006586
HIX0167892
HGNCiHGNC:3725 FKBP9
HPAiHPA012595
HPA055256
MIMi616257 gene
neXtProtiNX_O95302
OpenTargetsiENSG00000122642
PharmGKBiPA28166

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0549 Eukaryota
COG0545 LUCA
GeneTreeiENSGT00940000157125
HOVERGENiHBG051620
InParanoidiO95302
KOiK09575
OMAiEMIVKNM
OrthoDBi1507309at2759
PhylomeDBiO95302
TreeFamiTF105296

Enzyme and pathway databases

ReactomeiR-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FKBP9 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FKBP9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11328

Protein Ontology

More...
PROi
PR:O95302

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000122642 Expressed in 99 organ(s), highest expression level in adipose tissue
CleanExiHS_FKBP9
ExpressionAtlasiO95302 baseline and differential
GenevisibleiO95302 HS

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom
PANTHERiPTHR10516 PTHR10516, 7 hits
PfamiView protein in Pfam
PF00254 FKBP_C, 4 hits
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS00014 ER_TARGET, 1 hit
PS50059 FKBP_PPIASE, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFKBP9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95302
Secondary accession number(s): B3KY35
, B7Z1G9, B7Z6H3, Q2M2A1, Q3MIR7, Q6IN76, Q6P2N1, Q96EX5, Q96IJ9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: January 10, 2006
Last modified: January 16, 2019
This is version 168 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again