Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase FKBP9

Gene

FKBP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins during protein synthesis.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

Activity regulationi

Inhibited by FK506.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi501 – 5131PROSITE-ProRule annotationAdd BLAST13
Calcium bindingi546 – 5572PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIsomerase, Rotamase
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase FKBP9 (EC:5.2.1.8)
Short name:
PPIase FKBP9
Alternative name(s):
63 kDa FK506-binding protein
Short name:
63 kDa FKBP
Short name:
FKBP-63
FK506-binding protein 9
Short name:
FKBP-9
Rotamase
Gene namesi
Name:FKBP9
Synonyms:FKBP60, FKBP63
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000122642.10
HGNCiHGNC:3725 FKBP9
MIMi616257 gene
neXtProtiNX_O95302

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000122642
PharmGKBiPA28166

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000004576025 – 570Peptidyl-prolyl cis-trans isomerase FKBP9Add BLAST546

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi174N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi286N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi302N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi397N-linked (GlcNAc...) asparagine1 Publication1

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO95302
MaxQBiO95302
PaxDbiO95302
PeptideAtlasiO95302
PRIDEiO95302
ProteomicsDBi50800

PTM databases

GlyConnecti1598
iPTMnetiO95302
PhosphoSitePlusiO95302

Expressioni

Gene expression databases

BgeeiENSG00000122642 Expressed in 99 organ(s), highest expression level in adipose tissue
CleanExiHS_FKBP9
ExpressionAtlasiO95302 baseline and differential
GenevisibleiO95302 HS

Organism-specific databases

HPAiHPA012595
HPA055256

Interactioni

Protein-protein interaction databases

BioGridi116456, 39 interactors
IntActiO95302, 4 interactors
MINTiO95302
STRINGi9606.ENSP00000242209

Structurei

3D structure databases

ProteinModelPortaliO95302
SMRiO95302
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini54 – 142PPIase FKBP-type 1PROSITE-ProRule annotationAdd BLAST89
Domaini166 – 254PPIase FKBP-type 2PROSITE-ProRule annotationAdd BLAST89
Domaini278 – 365PPIase FKBP-type 3PROSITE-ProRule annotationAdd BLAST88
Domaini389 – 477PPIase FKBP-type 4PROSITE-ProRule annotationAdd BLAST89
Domaini488 – 523EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini533 – 568EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi567 – 570Prevents secretion from ERPROSITE-ProRule annotation4

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiKOG0549 Eukaryota
COG0545 LUCA
GeneTreeiENSGT00530000062784
HOVERGENiHBG051620
InParanoidiO95302
KOiK09575
OMAiEMIVKNM
OrthoDBiEOG091G02W1
PhylomeDBiO95302
TreeFamiTF105296

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom
PANTHERiPTHR10516 PTHR10516, 7 hits
PfamiView protein in Pfam
PF00254 FKBP_C, 4 hits
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS00014 ER_TARGET, 1 hit
PS50059 FKBP_PPIASE, 4 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O95302-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFRGWRPPP PPLLLLLLWV TGQAAPVAGL GSDAELQIER RFVPDECPRT
60 70 80 90 100
VRSGDFVRYH YVGTFPDGQK FDSSYDRDST FNVFVGKGQL ITGMDQALVG
110 120 130 140 150
MCVNERRFVK IPPKLAYGNE GVSGVIPPNS VLHFDVLLMD IWNSEDQVQI
160 170 180 190 200
HTYFKPPSCP RTIQVSDFVR YHYNGTFLDG TLFDSSHNRM KTYDTYVGIG
210 220 230 240 250
WLIPGMDKGL LGMCVGEKRI ITIPPFLAYG EDGDGKDIPG QASLVFDVAL
260 270 280 290 300
LDLHNPKDSI SIENKVVPEN CERISQSGDF LRYHYNGTLL DGTLFDSSYS
310 320 330 340 350
RNRTFDTYIG QGYVIPGMDE GLLGVCIGEK RRIVVPPHLG YGEEGRGNIP
360 370 380 390 400
GSAVLVFDIH VIDFHNPSDS ISITSHYKPP DCSVLSKKGD YLKYHYNASL
410 420 430 440 450
LDGTLLDSTW NLGKTYNIVL GSGQVVLGMD MGLREMCVGE KRTVIIPPHL
460 470 480 490 500
GYGEAGVDGE VPGSAVLVFD IELLELVAGL PEGYMFIWNG EVSPNLFEEI
510 520 530 540 550
DKDGNGEVLL EEFSEYIHAQ VASGKGKLAP GFDAELIVKN MFTNQDRNGD
560 570
GKVTAEEFKL KDQEAKHDEL
Length:570
Mass (Da):63,084
Last modified:January 10, 2006 - v2
Checksum:iE1F44A2FA6E112F8
GO
Isoform 2 (identifier: O95302-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-234: MAFRGWRPPP...PFLAYGEDGD → MA

Show »
Length:338
Mass (Da):37,047
Checksum:i2DAFD52806381800
GO
Isoform 3 (identifier: O95302-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-73: S → SRYWDTAEDKADKSPCPQVRVGVNTSPSCRLKQKGVGIYWKDLQFLVRVQNHGL

Show »
Length:623
Mass (Da):69,155
Checksum:i85E8B433A3631692
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4P8C9J4P8_HUMAN
Peptidylprolyl isomerase
FKBP9
225Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0548251 – 234MAFRG…GEDGD → MA in isoform 2. 1 PublicationAdd BLAST234
Alternative sequenceiVSP_05482673S → SRYWDTAEDKADKSPCPQVR VGVNTSPSCRLKQKGVGIYW KDLQFLVRVQNHGL in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128597 mRNA Translation: BAG54697.1
AK293440 mRNA Translation: BAH11505.1
AK300328 mRNA Translation: BAH13259.1
AC083863 Genomic DNA No translation available.
BC007443 mRNA Translation: AAH07443.2
BC064418 mRNA Translation: AAH64418.1
BC072422 mRNA Translation: AAH72422.1
BC101723 mRNA Translation: AAI01724.1
BC112053 mRNA Translation: AAI12054.1
AF089745 mRNA Translation: AAC78853.1
CCDSiCCDS5439.1 [O95302-1]
CCDS64622.1 [O95302-3]
CCDS64623.1 [O95302-2]
RefSeqiNP_001271270.1, NM_001284341.1 [O95302-3]
NP_001271272.1, NM_001284343.1 [O95302-2]
NP_009201.2, NM_007270.4 [O95302-1]
UniGeneiHs.103934

Genome annotation databases

EnsembliENST00000242209; ENSP00000242209; ENSG00000122642 [O95302-1]
ENST00000490776; ENSP00000441317; ENSG00000122642 [O95302-2]
ENST00000538336; ENSP00000439250; ENSG00000122642 [O95302-3]
GeneIDi11328
KEGGihsa:11328
UCSCiuc003tdh.5 human [O95302-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128597 mRNA Translation: BAG54697.1
AK293440 mRNA Translation: BAH11505.1
AK300328 mRNA Translation: BAH13259.1
AC083863 Genomic DNA No translation available.
BC007443 mRNA Translation: AAH07443.2
BC064418 mRNA Translation: AAH64418.1
BC072422 mRNA Translation: AAH72422.1
BC101723 mRNA Translation: AAI01724.1
BC112053 mRNA Translation: AAI12054.1
AF089745 mRNA Translation: AAC78853.1
CCDSiCCDS5439.1 [O95302-1]
CCDS64622.1 [O95302-3]
CCDS64623.1 [O95302-2]
RefSeqiNP_001271270.1, NM_001284341.1 [O95302-3]
NP_001271272.1, NM_001284343.1 [O95302-2]
NP_009201.2, NM_007270.4 [O95302-1]
UniGeneiHs.103934

3D structure databases

ProteinModelPortaliO95302
SMRiO95302
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116456, 39 interactors
IntActiO95302, 4 interactors
MINTiO95302
STRINGi9606.ENSP00000242209

PTM databases

GlyConnecti1598
iPTMnetiO95302
PhosphoSitePlusiO95302

Proteomic databases

EPDiO95302
MaxQBiO95302
PaxDbiO95302
PeptideAtlasiO95302
PRIDEiO95302
ProteomicsDBi50800

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000242209; ENSP00000242209; ENSG00000122642 [O95302-1]
ENST00000490776; ENSP00000441317; ENSG00000122642 [O95302-2]
ENST00000538336; ENSP00000439250; ENSG00000122642 [O95302-3]
GeneIDi11328
KEGGihsa:11328
UCSCiuc003tdh.5 human [O95302-1]

Organism-specific databases

CTDi11328
EuPathDBiHostDB:ENSG00000122642.10
GeneCardsiFKBP9
H-InvDBiHIX0006586
HIX0167892
HGNCiHGNC:3725 FKBP9
HPAiHPA012595
HPA055256
MIMi616257 gene
neXtProtiNX_O95302
OpenTargetsiENSG00000122642
PharmGKBiPA28166
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0549 Eukaryota
COG0545 LUCA
GeneTreeiENSGT00530000062784
HOVERGENiHBG051620
InParanoidiO95302
KOiK09575
OMAiEMIVKNM
OrthoDBiEOG091G02W1
PhylomeDBiO95302
TreeFamiTF105296

Enzyme and pathway databases

ReactomeiR-HSA-390471 Association of TriC/CCT with target proteins during biosynthesis

Miscellaneous databases

ChiTaRSiFKBP9 human
GeneWikiiFKBP9
GenomeRNAii11328
PROiPR:O95302
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122642 Expressed in 99 organ(s), highest expression level in adipose tissue
CleanExiHS_FKBP9
ExpressionAtlasiO95302 baseline and differential
GenevisibleiO95302 HS

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom
PANTHERiPTHR10516 PTHR10516, 7 hits
PfamiView protein in Pfam
PF00254 FKBP_C, 4 hits
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS00014 ER_TARGET, 1 hit
PS50059 FKBP_PPIASE, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFKBP9_HUMAN
AccessioniPrimary (citable) accession number: O95302
Secondary accession number(s): B3KY35
, B7Z1G9, B7Z6H3, Q2M2A1, Q3MIR7, Q6IN76, Q6P2N1, Q96EX5, Q96IJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: January 10, 2006
Last modified: November 7, 2018
This is version 166 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again