Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 178 (07 Apr 2021)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

Gene

NDUFA10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADNote: Binds 1 FAD per subunit.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processElectron transport, Respiratory chain, Transport
LigandFAD, Flavoprotein

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS05385-MONOMER

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O95299

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-611105, Respiratory electron transport
R-HSA-6799198, Complex I biogenesis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O95299

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Alternative name(s):
Complex I-42kD
Short name:
CI-42kD
NADH-ubiquinone oxidoreductase 42 kDa subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDUFA10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7684, NDUFA10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603835, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95299

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000130414.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mitochondrial complex I deficiency, nuclear type 22 (MC1DN22)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of mitochondrial complex I deficiency, the most common biochemical signature of mitochondrial disorders, a group of highly heterogeneous conditions characterized by defective oxidative phosphorylation, which collectively affects 1 in 5-10000 live births. Clinical disorders have variable severity, ranging from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. MC1DN22 transmission pattern is consistent with autosomal recessive inheritance.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078937142Q → R in MC1DN22. 1 PublicationCorresponds to variant dbSNP:rs387906873EnsemblClinVar.1
Natural variantiVAR_081458294L → P in MC1DN22; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1057519414EnsemblClinVar.1

Keywords - Diseasei

Disease variant, Primary mitochondrial disease

Organism-specific databases

DisGeNET

More...
DisGeNETi
4705

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
NDUFA10

MalaCards human disease database

More...
MalaCardsi
NDUFA10
MIMi618243, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000130414

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
255241, Leigh syndrome with leukodystrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31490

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O95299, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2363065

Drug and drug target database

More...
DrugBanki
DB00157, NADH

DrugCentral

More...
DrugCentrali
O95299

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NDUFA10

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 35MitochondrionBy similarityAdd BLAST35
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001998836 – 355NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrialAdd BLAST320

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei250Phosphoserine; by PINK1By similarity1
Modified residuei285N6-succinyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-250 by PINK1 is required for the binding and/or reduction of the complex I substrate ubiquinone.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95299

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95299

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O95299

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95299

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95299

PeptideAtlas

More...
PeptideAtlasi
O95299

PRoteomics IDEntifications database

More...
PRIDEi
O95299

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
50799 [O95299-1]
75009

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95299

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95299

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O95299

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000130414, Expressed in heart left ventricle and 233 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95299, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95299, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000130414, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Complex I is composed of 45 different subunits. This a component of the hydrophobic protein fraction.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
110785, 82 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-577, Mitochondrial respiratory chain complex I

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O95299

Protein interaction database and analysis system

More...
IntActi
O95299, 50 interactors

Molecular INTeraction database

More...
MINTi
O95299

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000252711

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O95299

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O95299, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95299

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the complex I NDUFA10 subunit family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3877, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016151

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_050591_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95299

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHEKPDL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95299

TreeFam database of animal gene trees

More...
TreeFami
TF314616

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02030, NDUO42, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031314, DNK_dom
IPR015828, NDUFA10
IPR027417, P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01712, dNK, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000543, NADH_UQ_42KD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 27 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95299-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALRLLKLAA TSASARVVAA GAQRVRGIHS SVQCKLRYGM WHFLLGDKAS
60 70 80 90 100
KRLTERSRVI TVDGNICTGK GKLAKEIAEK LGFKHFPEAG IHYPDSTTGD
110 120 130 140 150
GKPLATDYNG NCSLEKFYDD PRSNDGNSYR LQSWLYSSRL LQYSDALEHL
160 170 180 190 200
LTTGQGVVLE RSIFSDFVFL EAMYNQGFIR KQCVDHYNEV KSVTICDYLP
210 220 230 240 250
PHLVIYIDVP VPEVQRRIQK KGDPHEMKIT SAYLQDIENA YKKTFLPEMS
260 270 280 290 300
EKCEVLQYSA REAQDSKKVV EDIEYLKFDK GPWLKQDNRT LYHLRLLVQD
310 320 330 340 350
KFEVLNYTSI PIFLPEVTIG AHQTDRVLHQ FRELPGRKYS PGYNTEVGDK

WIWLK
Length:355
Mass (Da):40,751
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB5C27BC150A3E691
GO
Isoform 2 (identifier: O95299-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: C → CESALQTHFWTGVAGASGKLESGSSEEVLLINERGGRSKPG
     214-223: Missing.
     334-355: LPGRKYSPGYNTEVGDKWIWLK → RLDWTVCFGE...MHTTAFMFLC

Show »
Length:429
Mass (Da):48,563
Checksum:i37689EA2FA488544
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 27 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J6X0C9J6X0_HUMAN
Complex I-42kD
NDUFA10
244Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ESZ7E7ESZ7_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
390Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WXC5A0A087WXC5_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
371Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8N1B9Q8N1B9_HUMAN
NADH dehydrogenase (Ubiquinone) 1 a...
NDUFA10 hCG_20530
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1Y7H7C1Y7_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
362Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2X4H7C2X4_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
375Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2W5H7C2W5_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEH0F8WEH0_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V2F6A0A7I2V2F6_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
236Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V2I6A0A7I2V2I6_HUMAN
NADH dehydrogenase [ubiquinone] 1 a...
NDUFA10
202Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0341492A → G. Corresponds to variant dbSNP:rs11541494EnsemblClinVar.1
Natural variantiVAR_078937142Q → R in MC1DN22. 1 PublicationCorresponds to variant dbSNP:rs387906873EnsemblClinVar.1
Natural variantiVAR_081458294L → P in MC1DN22; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1057519414EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056417183C → CESALQTHFWTGVAGASGKL ESGSSEEVLLINERGGRSKP G in isoform 2. 1 Publication1
Alternative sequenceiVSP_056418214 – 223Missing in isoform 2. 1 Publication10
Alternative sequenceiVSP_056419334 – 355LPGRK…WIWLK → RLDWTVCFGEESTEVKHQGH LLSVQPGTVALTVGSWLRSC LLGLHWKLLFLFPESPMHTT AFMFLC in isoform 2. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF087661 mRNA Translation: AAD09755.1
AF453834 mRNA Translation: AAL50984.1
AC013469 Genomic DNA No translation available.
AC114750 Genomic DNA No translation available.
AC233275 Genomic DNA No translation available.
BC003417 mRNA Translation: AAH03417.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2531.1 [O95299-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0385

NCBI Reference Sequences

More...
RefSeqi
NP_004535.1, NM_004544.3 [O95299-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000252711; ENSP00000252711; ENSG00000130414 [O95299-1]
ENST00000307300; ENSP00000302321; ENSG00000130414 [O95299-2]
ENST00000676929; ENSP00000503956; ENSG00000130414 [O95299-1]
ENST00000678158; ENSP00000504765; ENSG00000130414 [O95299-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4705

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4705

UCSC genome browser

More...
UCSCi
uc002vyn.3, human [O95299-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087661 mRNA Translation: AAD09755.1
AF453834 mRNA Translation: AAL50984.1
AC013469 Genomic DNA No translation available.
AC114750 Genomic DNA No translation available.
AC233275 Genomic DNA No translation available.
BC003417 mRNA Translation: AAH03417.1
CCDSiCCDS2531.1 [O95299-1]
PIRiJE0385
RefSeqiNP_004535.1, NM_004544.3 [O95299-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70w36-355[»]
5XTDelectron microscopy3.70w36-355[»]
5XTHelectron microscopy3.90w36-355[»]
5XTIelectron microscopy17.40Bw/w36-355[»]
SMRiO95299
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110785, 82 interactors
ComplexPortaliCPX-577, Mitochondrial respiratory chain complex I
CORUMiO95299
IntActiO95299, 50 interactors
MINTiO95299
STRINGi9606.ENSP00000252711

Chemistry databases

BindingDBiO95299
ChEMBLiCHEMBL2363065
DrugBankiDB00157, NADH
DrugCentraliO95299

PTM databases

iPTMnetiO95299
PhosphoSitePlusiO95299
SwissPalmiO95299

Genetic variation databases

BioMutaiNDUFA10

Proteomic databases

EPDiO95299
jPOSTiO95299
MassIVEiO95299
MaxQBiO95299
PaxDbiO95299
PeptideAtlasiO95299
PRIDEiO95299
ProteomicsDBi50799 [O95299-1]
75009

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34509, 192 antibodies

The DNASU plasmid repository

More...
DNASUi
4705

Genome annotation databases

EnsembliENST00000252711; ENSP00000252711; ENSG00000130414 [O95299-1]
ENST00000307300; ENSP00000302321; ENSG00000130414 [O95299-2]
ENST00000676929; ENSP00000503956; ENSG00000130414 [O95299-1]
ENST00000678158; ENSP00000504765; ENSG00000130414 [O95299-1]
GeneIDi4705
KEGGihsa:4705
UCSCiuc002vyn.3, human [O95299-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4705
DisGeNETi4705

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NDUFA10
GeneReviewsiNDUFA10
HGNCiHGNC:7684, NDUFA10
HPAiENSG00000130414, Low tissue specificity
MalaCardsiNDUFA10
MIMi603835, gene
618243, phenotype
neXtProtiNX_O95299
OpenTargetsiENSG00000130414
Orphaneti255241, Leigh syndrome with leukodystrophy
PharmGKBiPA31490
VEuPathDBiHostDB:ENSG00000130414.11

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3877, Eukaryota
GeneTreeiENSGT00390000016151
HOGENOMiCLU_050591_0_0_1
InParanoidiO95299
OMAiCHEKPDL
PhylomeDBiO95299
TreeFamiTF314616

Enzyme and pathway databases

BioCyciMetaCyc:HS05385-MONOMER
PathwayCommonsiO95299
ReactomeiR-HSA-611105, Respiratory electron transport
R-HSA-6799198, Complex I biogenesis
SIGNORiO95299

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
4705, 162 hits in 997 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NDUFA10, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NDUFA10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4705
PharosiO95299, Tclin

Protein Ontology

More...
PROi
PR:O95299
RNActiO95299, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000130414, Expressed in heart left ventricle and 233 other tissues
ExpressionAtlasiO95299, baseline and differential
GenevisibleiO95299, HS

Family and domain databases

CDDicd02030, NDUO42, 1 hit
InterProiView protein in InterPro
IPR031314, DNK_dom
IPR015828, NDUFA10
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF01712, dNK, 1 hit
PIRSFiPIRSF000543, NADH_UQ_42KD, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDUAA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95299
Secondary accession number(s): Q8WXC9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 1, 1999
Last modified: April 7, 2021
This is version 178 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again