Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (13 Feb 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

NADH dehydrogenase [ubiquinone] 1 subunit C2

Gene

NDUFC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processElectron transport, Respiratory chain, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-611105 Respiratory electron transport
R-HSA-6798695 Neutrophil degranulation
R-HSA-6799198 Complex I biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 subunit C2
Alternative name(s):
Complex I-B14.5b
Short name:
CI-B14.5b
Human lung cancer oncogene 1 protein
Short name:
HLC-1
NADH-ubiquinone oxidoreductase subunit B14.5b
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDUFC2
ORF Names:HLC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000151366.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7706 NDUFC2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603845 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95298

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei56 – 75HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4718

Open Targets

More...
OpenTargetsi
ENSG00000151366

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31517

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2363065

Drug and drug target database

More...
DrugBanki
DB01136 Carvedilol
DB00157 NADH

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NDUFC2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001188371 – 119NADH dehydrogenase [ubiquinone] 1 subunit C2Add BLAST119

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95298

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95298

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95298

PeptideAtlas

More...
PeptideAtlasi
O95298

PRoteomics IDEntifications database

More...
PRIDEi
O95298

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50798

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O95298-1 [O95298-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95298

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95298

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151366 Expressed in 187 organ(s), highest expression level in right adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95298 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95298 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038873
HPA056195

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Complex I is composed of 45 different subunits.2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110798, 28 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-577 Mitochondrial respiratory chain complex I

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O95298

Protein interaction database and analysis system

More...
IntActi
O95298, 11 interactors

Molecular INTeraction database

More...
MINTi
O95298

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000281031

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70g1-119[»]
5XTDelectron microscopy3.70g1-119[»]
5XTHelectron microscopy3.90g1-119[»]
5XTIelectron microscopy17.40Bg/g1-119[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95298

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95298

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the complex I NDUFC2 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4516 Eukaryota
ENOG410Y341 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010352

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113753

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001727

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95298

KEGG Orthology (KO)

More...
KOi
K03968

Identification of Orthologs from Complete Genome Data

More...
OMAi
IVEPFHP

Database of Orthologous Groups

More...
OrthoDBi
1606491at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95298

TreeFam database of animal gene trees

More...
TreeFami
TF314723

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009423 NADH-UbQ_OxRdtase_b14.5b_su

The PANTHER Classification System

More...
PANTHERi
PTHR13099 PTHR13099, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06374 NDUF_C2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF017834 NADH-UbQ_OxRdtase_b14.5b, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: O95298-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIARRNPEPL RFLPDEARSL PPPKLTDPRL LYIGFLGYCS GLIDNLIRRR
60 70 80 90 100
PIATAGLHRQ LLYITAFFFA GYYLVKREDY LYAVRDREMF GYMKLHPEDF
110
PEEDKKTYGE IFEKFHPIR
Length:119
Mass (Da):14,188
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9A47DEE33DC9244D
GO
Isoform 4 (identifier: O95298-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-78: Missing.

Note: Gene prediction based on EST data.
Show »
Length:96
Mass (Da):11,399
Checksum:i5144A1E115F55FF6
GO
Isoform 5 (identifier: O95298-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-119: REDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR → LEAYANLYVDTL

Note: Gene prediction based on EST data.
Show »
Length:88
Mass (Da):10,145
Checksum:i8D7F15EF0BFAC7CE
GO
Isoform 2 (identifier: E9PQ53-1) [UniParc]FASTAAdd to basket
Also known as: NDUFC2-KCTD14
The sequence of this isoform can be found in the external entry E9PQ53.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Based on a readthrough transcript which may produce a NDUFC2-KCTD14 fusion protein. No experimental confirmation available.
Length:114
Mass (Da):13,408
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PM14E9PM14_HUMAN
NADH dehydrogenase [ubiquinone] 1 s...
NDUFC2
107Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRJ5E9PRJ5_HUMAN
NADH dehydrogenase [ubiquinone] 1 s...
NDUFC2
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01448646L → V4 PublicationsCorresponds to variant dbSNP:rs8875Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04731756 – 78Missing in isoform 4. CuratedAdd BLAST23
Alternative sequenceiVSP_04731877 – 119REDYL…FHPIR → LEAYANLYVDTL in isoform 5. CuratedAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF087659 mRNA Translation: AAD09754.1
AF087899 mRNA Translation: AAP97198.1
AF070652 mRNA Translation: AAD20958.1
AL050278 mRNA Translation: CAB43379.1
AF369951 mRNA Translation: AAM21294.1
CR533448 mRNA Translation: CAG38479.1
AP003032 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75046.1
BC007323 mRNA Translation: AAH07323.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55779.1 [O95298-2]
CCDS55781.1 [O95298-3]
CCDS8257.1 [O95298-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08728

NCBI Reference Sequences

More...
RefSeqi
NP_001190983.1, NM_001204054.1 [O95298-3]
NP_001190984.1, NM_001204055.1 [O95298-2]
NP_004540.1, NM_004549.5 [O95298-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.407860

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000281031; ENSP00000281031; ENSG00000151366 [O95298-1]
ENST00000525085; ENSP00000434262; ENSG00000151366 [O95298-2]
ENST00000527806; ENSP00000432739; ENSG00000151366 [O95298-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4718

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4718

UCSC genome browser

More...
UCSCi
uc009yuw.4 human [O95298-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087659 mRNA Translation: AAD09754.1
AF087899 mRNA Translation: AAP97198.1
AF070652 mRNA Translation: AAD20958.1
AL050278 mRNA Translation: CAB43379.1
AF369951 mRNA Translation: AAM21294.1
CR533448 mRNA Translation: CAG38479.1
AP003032 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75046.1
BC007323 mRNA Translation: AAH07323.1
CCDSiCCDS55779.1 [O95298-2]
CCDS55781.1 [O95298-3]
CCDS8257.1 [O95298-1]
PIRiT08728
RefSeqiNP_001190983.1, NM_001204054.1 [O95298-3]
NP_001190984.1, NM_001204055.1 [O95298-2]
NP_004540.1, NM_004549.5 [O95298-1]
UniGeneiHs.407860

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70g1-119[»]
5XTDelectron microscopy3.70g1-119[»]
5XTHelectron microscopy3.90g1-119[»]
5XTIelectron microscopy17.40Bg/g1-119[»]
ProteinModelPortaliO95298
SMRiO95298
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110798, 28 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO95298
IntActiO95298, 11 interactors
MINTiO95298
STRINGi9606.ENSP00000281031

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB01136 Carvedilol
DB00157 NADH

PTM databases

iPTMnetiO95298
PhosphoSitePlusiO95298

Polymorphism and mutation databases

BioMutaiNDUFC2

Proteomic databases

EPDiO95298
jPOSTiO95298
PaxDbiO95298
PeptideAtlasiO95298
PRIDEiO95298
ProteomicsDBi50798
TopDownProteomicsiO95298-1 [O95298-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4718
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281031; ENSP00000281031; ENSG00000151366 [O95298-1]
ENST00000525085; ENSP00000434262; ENSG00000151366 [O95298-2]
ENST00000527806; ENSP00000432739; ENSG00000151366 [O95298-3]
GeneIDi4718
KEGGihsa:4718
UCSCiuc009yuw.4 human [O95298-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4718
DisGeNETi4718
EuPathDBiHostDB:ENSG00000151366.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NDUFC2
HGNCiHGNC:7706 NDUFC2
HPAiHPA038873
HPA056195
MIMi603845 gene
neXtProtiNX_O95298
OpenTargetsiENSG00000151366
PharmGKBiPA31517

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4516 Eukaryota
ENOG410Y341 LUCA
GeneTreeiENSGT00390000010352
HOGENOMiHOG000113753
HOVERGENiHBG001727
InParanoidiO95298
KOiK03968
OMAiIVEPFHP
OrthoDBi1606491at2759
PhylomeDBiO95298
TreeFamiTF314723

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6798695 Neutrophil degranulation
R-HSA-6799198 Complex I biogenesis

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NDUFC2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4718

Protein Ontology

More...
PROi
PR:O95298

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000151366 Expressed in 187 organ(s), highest expression level in right adrenal gland
ExpressionAtlasiO95298 baseline and differential
GenevisibleiO95298 HS

Family and domain databases

InterProiView protein in InterPro
IPR009423 NADH-UbQ_OxRdtase_b14.5b_su
PANTHERiPTHR13099 PTHR13099, 1 hit
PfamiView protein in Pfam
PF06374 NDUF_C2, 1 hit
PIRSFiPIRSF017834 NADH-UbQ_OxRdtase_b14.5b, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDUC2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95298
Secondary accession number(s): E9PNU8
, E9PRB2, Q549M5, Q6FIH8, Q9UBJ9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 1, 1999
Last modified: February 13, 2019
This is version 153 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again