Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH dehydrogenase [ubiquinone] 1 subunit C2

Gene

NDUFC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processElectron transport, Respiratory chain, Transport

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6798695 Neutrophil degranulation
R-HSA-6799198 Complex I biogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 subunit C2
Alternative name(s):
Complex I-B14.5b
Short name:
CI-B14.5b
Human lung cancer oncogene 1 protein
Short name:
HLC-1
NADH-ubiquinone oxidoreductase subunit B14.5b
Gene namesi
Name:NDUFC2
ORF Names:HLC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000151366.12
HGNCiHGNC:7706 NDUFC2
MIMi603845 gene
neXtProtiNX_O95298

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei56 – 75HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4718
OpenTargetsiENSG00000151366
PharmGKBiPA31517

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB01136 Carvedilol
DB00157 NADH

Polymorphism and mutation databases

BioMutaiNDUFC2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001188371 – 119NADH dehydrogenase [ubiquinone] 1 subunit C2Add BLAST119

Proteomic databases

EPDiO95298
PaxDbiO95298
PeptideAtlasiO95298
PRIDEiO95298
ProteomicsDBi50798
TopDownProteomicsiO95298-1 [O95298-1]

PTM databases

iPTMnetiO95298
PhosphoSitePlusiO95298

Expressioni

Gene expression databases

BgeeiENSG00000151366 Expressed in 187 organ(s), highest expression level in right adrenal gland
CleanExiHS_NDUFC2
ExpressionAtlasiO95298 baseline and differential
GenevisibleiO95298 HS

Organism-specific databases

HPAiHPA038873
HPA056195

Interactioni

Subunit structurei

Complex I is composed of 45 different subunits.2 Publications

Protein-protein interaction databases

BioGridi110798, 28 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO95298
IntActiO95298, 11 interactors
MINTiO95298
STRINGi9606.ENSP00000281031

Structurei

3D structure databases

ProteinModelPortaliO95298
SMRiO95298
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the complex I NDUFC2 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4516 Eukaryota
ENOG410Y341 LUCA
GeneTreeiENSGT00390000010352
HOGENOMiHOG000113753
HOVERGENiHBG001727
InParanoidiO95298
KOiK03968
OMAiIVEPFHP
OrthoDBiEOG091G0ZKK
PhylomeDBiO95298
TreeFamiTF314723

Family and domain databases

InterProiView protein in InterPro
IPR009423 NADH-UbQ_OxRdtase_b14.5b_su
PANTHERiPTHR13099 PTHR13099, 1 hit
PfamiView protein in Pfam
PF06374 NDUF_C2, 1 hit
PIRSFiPIRSF017834 NADH-UbQ_OxRdtase_b14.5b, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: O95298-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIARRNPEPL RFLPDEARSL PPPKLTDPRL LYIGFLGYCS GLIDNLIRRR
60 70 80 90 100
PIATAGLHRQ LLYITAFFFA GYYLVKREDY LYAVRDREMF GYMKLHPEDF
110
PEEDKKTYGE IFEKFHPIR
Length:119
Mass (Da):14,188
Last modified:May 1, 1999 - v1
Checksum:i9A47DEE33DC9244D
GO
Isoform 4 (identifier: O95298-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-78: Missing.

Note: Gene prediction based on EST data.
Show »
Length:96
Mass (Da):11,399
Checksum:i5144A1E115F55FF6
GO
Isoform 5 (identifier: O95298-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-119: REDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR → LEAYANLYVDTL

Note: Gene prediction based on EST data.
Show »
Length:88
Mass (Da):10,145
Checksum:i8D7F15EF0BFAC7CE
GO
Isoform 2 (identifier: E9PQ53-1) [UniParc]FASTAAdd to basket
Also known as: NDUFC2-KCTD14
The sequence of this isoform can be found in the external entry E9PQ53.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Based on a readthrough transcript which may produce a NDUFC2-KCTD14 fusion protein. No experimental confirmation available.
Length:114
Mass (Da):13,408
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PM14E9PM14_HUMAN
NADH dehydrogenase [ubiquinone] 1 s...
NDUFC2
107Annotation score:
E9PRJ5E9PRJ5_HUMAN
NADH dehydrogenase [ubiquinone] 1 s...
NDUFC2
71Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01448646L → V4 PublicationsCorresponds to variant dbSNP:rs8875Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04731756 – 78Missing in isoform 4. CuratedAdd BLAST23
Alternative sequenceiVSP_04731877 – 119REDYL…FHPIR → LEAYANLYVDTL in isoform 5. CuratedAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087659 mRNA Translation: AAD09754.1
AF087899 mRNA Translation: AAP97198.1
AF070652 mRNA Translation: AAD20958.1
AL050278 mRNA Translation: CAB43379.1
AF369951 mRNA Translation: AAM21294.1
CR533448 mRNA Translation: CAG38479.1
AP003032 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75046.1
BC007323 mRNA Translation: AAH07323.1
CCDSiCCDS55779.1 [O95298-2]
CCDS55781.1 [O95298-3]
CCDS8257.1 [O95298-1]
PIRiT08728
RefSeqiNP_001190983.1, NM_001204054.1 [O95298-3]
NP_001190984.1, NM_001204055.1 [O95298-2]
NP_004540.1, NM_004549.5 [O95298-1]
UniGeneiHs.407860

Genome annotation databases

EnsembliENST00000281031; ENSP00000281031; ENSG00000151366 [O95298-1]
ENST00000525085; ENSP00000434262; ENSG00000151366 [O95298-2]
ENST00000527806; ENSP00000432739; ENSG00000151366 [O95298-3]
GeneIDi4718
KEGGihsa:4718
UCSCiuc009yuw.4 human [O95298-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087659 mRNA Translation: AAD09754.1
AF087899 mRNA Translation: AAP97198.1
AF070652 mRNA Translation: AAD20958.1
AL050278 mRNA Translation: CAB43379.1
AF369951 mRNA Translation: AAM21294.1
CR533448 mRNA Translation: CAG38479.1
AP003032 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75046.1
BC007323 mRNA Translation: AAH07323.1
CCDSiCCDS55779.1 [O95298-2]
CCDS55781.1 [O95298-3]
CCDS8257.1 [O95298-1]
PIRiT08728
RefSeqiNP_001190983.1, NM_001204054.1 [O95298-3]
NP_001190984.1, NM_001204055.1 [O95298-2]
NP_004540.1, NM_004549.5 [O95298-1]
UniGeneiHs.407860

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70g1-119[»]
5XTDelectron microscopy3.70g1-119[»]
5XTHelectron microscopy3.90g1-119[»]
5XTIelectron microscopy17.40Bg/g1-119[»]
ProteinModelPortaliO95298
SMRiO95298
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110798, 28 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO95298
IntActiO95298, 11 interactors
MINTiO95298
STRINGi9606.ENSP00000281031

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB01136 Carvedilol
DB00157 NADH

PTM databases

iPTMnetiO95298
PhosphoSitePlusiO95298

Polymorphism and mutation databases

BioMutaiNDUFC2

Proteomic databases

EPDiO95298
PaxDbiO95298
PeptideAtlasiO95298
PRIDEiO95298
ProteomicsDBi50798
TopDownProteomicsiO95298-1 [O95298-1]

Protocols and materials databases

DNASUi4718
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000281031; ENSP00000281031; ENSG00000151366 [O95298-1]
ENST00000525085; ENSP00000434262; ENSG00000151366 [O95298-2]
ENST00000527806; ENSP00000432739; ENSG00000151366 [O95298-3]
GeneIDi4718
KEGGihsa:4718
UCSCiuc009yuw.4 human [O95298-1]

Organism-specific databases

CTDi4718
DisGeNETi4718
EuPathDBiHostDB:ENSG00000151366.12
GeneCardsiNDUFC2
HGNCiHGNC:7706 NDUFC2
HPAiHPA038873
HPA056195
MIMi603845 gene
neXtProtiNX_O95298
OpenTargetsiENSG00000151366
PharmGKBiPA31517
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4516 Eukaryota
ENOG410Y341 LUCA
GeneTreeiENSGT00390000010352
HOGENOMiHOG000113753
HOVERGENiHBG001727
InParanoidiO95298
KOiK03968
OMAiIVEPFHP
OrthoDBiEOG091G0ZKK
PhylomeDBiO95298
TreeFamiTF314723

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6798695 Neutrophil degranulation
R-HSA-6799198 Complex I biogenesis

Miscellaneous databases

GeneWikiiNDUFC2
GenomeRNAii4718
PROiPR:O95298
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151366 Expressed in 187 organ(s), highest expression level in right adrenal gland
CleanExiHS_NDUFC2
ExpressionAtlasiO95298 baseline and differential
GenevisibleiO95298 HS

Family and domain databases

InterProiView protein in InterPro
IPR009423 NADH-UbQ_OxRdtase_b14.5b_su
PANTHERiPTHR13099 PTHR13099, 1 hit
PfamiView protein in Pfam
PF06374 NDUF_C2, 1 hit
PIRSFiPIRSF017834 NADH-UbQ_OxRdtase_b14.5b, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNDUC2_HUMAN
AccessioniPrimary (citable) accession number: O95298
Secondary accession number(s): E9PNU8
, E9PRB2, Q549M5, Q6FIH8, Q9UBJ9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: May 1, 1999
Last modified: October 10, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again