Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin protein zero-like protein 1

Gene

MPZL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 3 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2 and isoform 3, may be involved in regulation of integrin-mediated cell motility.2 Publications

GO - Molecular functioni

  • structural molecule activity Source: ProtInc

GO - Biological processi

Enzyme and pathway databases

SignaLinkiO95297
SIGNORiO95297

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin protein zero-like protein 1
Alternative name(s):
Protein zero-related
Gene namesi
Name:MPZL1
Synonyms:PZR
ORF Names:UNQ849/PRO1787
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000197965.11
HGNCiHGNC:7226 MPZL1
MIMi604376 gene
neXtProtiNX_O95297

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini36 – 162ExtracellularSequence analysisAdd BLAST127
Transmembranei163 – 183HelicalSequence analysisAdd BLAST21
Topological domaini184 – 269CytoplasmicSequence analysisAdd BLAST86

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi241Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-263. 1 Publication1
Mutagenesisi263Y → F: Significantly decreases phosphorylation. Complete loss of phosphorylation; when associated with F-241. 1 Publication1

Organism-specific databases

DisGeNETi9019
OpenTargetsiENSG00000197965
PharmGKBiPA30931

Polymorphism and mutation databases

BioMutaiMPZL1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 35Sequence analysisAdd BLAST35
ChainiPRO_000024033536 – 269Myelin protein zero-like protein 1Add BLAST234

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi50N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi58 ↔ 135PROSITE-ProRule annotation
Glycosylationi130N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei204PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei208PhosphoserineCombined sources1
Modified residuei210PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei241PhosphotyrosineCombined sources1 Publication1
Modified residuei260PhosphoserineCombined sources1
Modified residuei263PhosphotyrosineCombined sources1 Publication1

Post-translational modificationi

Phosphorylated on tyrosine residues upon stimulation with pervanadate and concanavalin-A (ConA). Phosphorylation at Tyr-241 and Tyr-263 is required for interaction with PTPN11/SHP-2. Dephosphorylated by PTPN11/SHP-2 (in vitro).3 Publications
N-glycosylated.3 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO95297
MaxQBiO95297
PaxDbiO95297
PeptideAtlasiO95297
PRIDEiO95297
ProteomicsDBi50793
50794 [O95297-2]
50795 [O95297-3]
50796 [O95297-4]
50797 [O95297-5]
TopDownProteomicsiO95297-1 [O95297-1]

PTM databases

GlyConnecti1527
iPTMnetiO95297
PhosphoSitePlusiO95297

Expressioni

Tissue specificityi

Widely expressed with highest levels in heart, placenta, kidney and pancreas. Isoform 3 is relatively abundant in hematopoietic tissues and fetal liver. Isoform 1 and isoform 3 are expressed in CD14- PB monocytes and pre-B cell progenitors. Isoform 3 appears to be the major isoform in CD34- promyelocytic and promonocytic cells. During differentiation in monocytic cells, the expression level of isoform 3 decreases and that of isoform 1 increases. Isoform 1 is prominent in stromal cells and, to a lesser extent, in umbilical vein endothelial cells and erythroid progenitors. Isoform 2 is expressed in a erythroid progenitor cell line.3 Publications

Gene expression databases

BgeeiENSG00000197965 Expressed in 219 organ(s), highest expression level in urinary bladder
CleanExiHS_MPZL1
ExpressionAtlasiO95297 baseline and differential
GenevisibleiO95297 HS

Organism-specific databases

HPAiHPA026966
HPA063538

Interactioni

Subunit structurei

Interacts with phosphorylated PTPN11/SHP-2.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN11Q061244EBI-963338,EBI-297779

Protein-protein interaction databases

BioGridi114486, 61 interactors
IntActiO95297, 23 interactors
MINTiO95297
STRINGi9606.ENSP00000352513

Structurei

3D structure databases

ProteinModelPortaliO95297
SMRiO95297
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 146Ig-like V-typeAdd BLAST111

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi239 – 244ITIM motif 16
Motifi261 – 266ITIM motif 26

Domaini

Sequence similaritiesi

Belongs to the myelin P0 protein family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVXC Eukaryota
ENOG4111MDZ LUCA
GeneTreeiENSGT00900000140913
HOGENOMiHOG000059672
HOVERGENiHBG104511
InParanoidiO95297
KOiK06770
OMAiPGNYPPF
OrthoDBiEOG091G0H91
PhylomeDBiO95297
TreeFamiTF331728

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel
PANTHERiPTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PRINTSiPR00213 MYELINP0
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95297-1) [UniParc]FASTAAdd to basket
Also known as: MPZL1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASAGAGAV IAAPDSRRWL WSVLAAALGL LTAGVSALEV YTPKEIFVAN
60 70 80 90 100
GTQGKLTCKF KSTSTTGGLT SVSWSFQPEG ADTTVSFFHY SQGQVYLGNY
110 120 130 140 150
PPFKDRISWA GDLDKKDASI NIENMQFIHN GTYICDVKNP PDIVVQPGHI
160 170 180 190 200
RLYVVEKENL PVFPVWVVVG IVTAVVLGLT LLISMILAVL YRRKNSKRDY
210 220 230 240 250
TGCSTSESLS PVKQAPRKSP SDTEGLVKSL PSGSHQGPVI YAQLDHSGGH
260
HSDKINKSES VVYADIRKN
Length:269
Mass (Da):29,082
Last modified:May 1, 1999 - v1
Checksum:iA1B299041EE59425
GO
Isoform 2 (identifier: O95297-2) [UniParc]FASTAAdd to basket
Also known as: PZR1a

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: Missing.

Show »
Length:268
Mass (Da):28,981
Checksum:iC696D8EE3C297715
GO
Isoform 3 (identifier: O95297-3) [UniParc]FASTAAdd to basket
Also known as: PZR1b

The sequence of this isoform differs from the canonical sequence as follows:
     203-269: CSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN → AQSYMHS

Show »
Length:209
Mass (Da):22,761
Checksum:i18EC385959C88329
GO
Isoform 4 (identifier: O95297-4) [UniParc]FASTAAdd to basket
Also known as: MPZL1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:145
Mass (Da):15,947
Checksum:i64F88C2B041B87F8
GO
Isoform 5 (identifier: O95297-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-236: Missing.

Note: No experimental confirmation available.
Show »
Length:119
Mass (Da):12,354
Checksum:i56BDFA661BA6A9EB
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WFC4F8WFC4_HUMAN
Myelin protein zero-like protein 1
MPZL1
95Annotation score:
Q9UEL6Q9UEL6_HUMAN
Myelin protein zero-like protein 1
MPZL1
183Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42T → A in AAO14646 (PubMed:12410637).Curated1
Sequence conflicti177L → I in AAO14646 (PubMed:12410637).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193421 – 124Missing in isoform 4. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_01934342Missing in isoform 2. Curated1
Alternative sequenceiVSP_04334187 – 236Missing in isoform 5. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_019344203 – 269CSTSE…DIRKN → AQSYMHS in isoform 3. 2 PublicationsAdd BLAST67

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087020 mRNA Translation: AAC72231.1
AF092424 mRNA Translation: AAD55346.1
AF092425 mRNA Translation: AAD55347.1
AF095726 mRNA Translation: AAF00083.1
AF095727 mRNA Translation: AAF00084.1
AF239756 mRNA Translation: AAF63499.1
AF478447 mRNA Translation: AAO14645.1
AF478448 Genomic DNA Translation: AAO14647.1
AF478448 Genomic DNA Translation: AAO14646.1
AY359019 mRNA Translation: AAQ89378.1
AK297112 mRNA Translation: BAH12501.1
CR542160 mRNA Translation: CAG46957.1
AL356532 Genomic DNA No translation available.
Z99943 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90800.1
BC007881 mRNA Translation: AAH07881.1
CCDSiCCDS1264.1 [O95297-1]
CCDS44273.1 [O95297-3]
CCDS53425.1 [O95297-5]
RefSeqiNP_001139663.1, NM_001146191.1 [O95297-5]
NP_003944.1, NM_003953.5 [O95297-1]
NP_078845.3, NM_024569.4 [O95297-3]
UniGeneiHs.493919

Genome annotation databases

EnsembliENST00000359523; ENSP00000352513; ENSG00000197965 [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965 [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965 [O95297-3]
GeneIDi9019
KEGGihsa:9019
UCSCiuc001geo.3 human [O95297-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087020 mRNA Translation: AAC72231.1
AF092424 mRNA Translation: AAD55346.1
AF092425 mRNA Translation: AAD55347.1
AF095726 mRNA Translation: AAF00083.1
AF095727 mRNA Translation: AAF00084.1
AF239756 mRNA Translation: AAF63499.1
AF478447 mRNA Translation: AAO14645.1
AF478448 Genomic DNA Translation: AAO14647.1
AF478448 Genomic DNA Translation: AAO14646.1
AY359019 mRNA Translation: AAQ89378.1
AK297112 mRNA Translation: BAH12501.1
CR542160 mRNA Translation: CAG46957.1
AL356532 Genomic DNA No translation available.
Z99943 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90800.1
BC007881 mRNA Translation: AAH07881.1
CCDSiCCDS1264.1 [O95297-1]
CCDS44273.1 [O95297-3]
CCDS53425.1 [O95297-5]
RefSeqiNP_001139663.1, NM_001146191.1 [O95297-5]
NP_003944.1, NM_003953.5 [O95297-1]
NP_078845.3, NM_024569.4 [O95297-3]
UniGeneiHs.493919

3D structure databases

ProteinModelPortaliO95297
SMRiO95297
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114486, 61 interactors
IntActiO95297, 23 interactors
MINTiO95297
STRINGi9606.ENSP00000352513

PTM databases

GlyConnecti1527
iPTMnetiO95297
PhosphoSitePlusiO95297

Polymorphism and mutation databases

BioMutaiMPZL1

Proteomic databases

EPDiO95297
MaxQBiO95297
PaxDbiO95297
PeptideAtlasiO95297
PRIDEiO95297
ProteomicsDBi50793
50794 [O95297-2]
50795 [O95297-3]
50796 [O95297-4]
50797 [O95297-5]
TopDownProteomicsiO95297-1 [O95297-1]

Protocols and materials databases

DNASUi9019
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359523; ENSP00000352513; ENSG00000197965 [O95297-1]
ENST00000392121; ENSP00000375968; ENSG00000197965 [O95297-5]
ENST00000474859; ENSP00000420455; ENSG00000197965 [O95297-3]
GeneIDi9019
KEGGihsa:9019
UCSCiuc001geo.3 human [O95297-1]

Organism-specific databases

CTDi9019
DisGeNETi9019
EuPathDBiHostDB:ENSG00000197965.11
GeneCardsiMPZL1
H-InvDBiHIX0001303
HGNCiHGNC:7226 MPZL1
HPAiHPA026966
HPA063538
MIMi604376 gene
neXtProtiNX_O95297
OpenTargetsiENSG00000197965
PharmGKBiPA30931
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVXC Eukaryota
ENOG4111MDZ LUCA
GeneTreeiENSGT00900000140913
HOGENOMiHOG000059672
HOVERGENiHBG104511
InParanoidiO95297
KOiK06770
OMAiPGNYPPF
OrthoDBiEOG091G0H91
PhylomeDBiO95297
TreeFamiTF331728

Enzyme and pathway databases

SignaLinkiO95297
SIGNORiO95297

Miscellaneous databases

ChiTaRSiMPZL1 human
GeneWikiiMPZL1
GenomeRNAii9019
PROiPR:O95297
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197965 Expressed in 219 organ(s), highest expression level in urinary bladder
CleanExiHS_MPZL1
ExpressionAtlasiO95297 baseline and differential
GenevisibleiO95297 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel
PANTHERiPTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PRINTSiPR00213 MYELINP0
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMPZL1_HUMAN
AccessioniPrimary (citable) accession number: O95297
Secondary accession number(s): B2REB9
, B2REC0, Q5R332, Q8IX11, Q9BWZ3, Q9NYK4, Q9UL20
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: May 1, 1999
Last modified: November 7, 2018
This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again