Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain mitochondrial carrier protein 1

Gene

SLC25A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Participates in the mitochondrial proton leak measured in brain mitochondria.

GO - Molecular functioni

GO - Biological processi

  • aerobic respiration Source: ProtInc
  • mitochondrial transport Source: GO_Central

Keywordsi

Biological processTransport

Enzyme and pathway databases

ReactomeiR-HSA-167826 The fatty acid cycling model
R-HSA-167827 The proton buffering model

Protein family/group databases

TCDBi2.A.29.24.1 the mitochondrial carrier (mc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Brain mitochondrial carrier protein 1
Short name:
BMCP-1
Alternative name(s):
Mitochondrial uncoupling protein 5
Short name:
UCP 5
Solute carrier family 25 member 14
Gene namesi
Name:SLC25A14
Synonyms:BMCP1, UCP5
ORF Names:UNQ791/PRO1682
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000102078.15
HGNCiHGNC:10984 SLC25A14
MIMi300242 gene
neXtProtiNX_O95258

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei38 – 54Helical; Name=1Sequence analysisAdd BLAST17
Transmembranei112 – 128Helical; Name=2Sequence analysisAdd BLAST17
Transmembranei141 – 161Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei199 – 215Helical; Name=4Sequence analysisAdd BLAST17
Transmembranei240 – 256Helical; Name=5Sequence analysisAdd BLAST17
Transmembranei298 – 315Helical; Name=6Sequence analysisAdd BLAST18

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9016
OpenTargetsiENSG00000102078
PharmGKBiPA35860

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000906771 – 325Brain mitochondrial carrier protein 1Add BLAST325

Proteomic databases

EPDiO95258
MaxQBiO95258
PaxDbiO95258
PeptideAtlasiO95258
PRIDEiO95258
ProteomicsDBi50752
50753 [O95258-2]
50754 [O95258-3]

PTM databases

iPTMnetiO95258
PhosphoSitePlusiO95258

Expressioni

Tissue specificityi

Mainly expressed in brain. Some expression in testis and pituitary.1 Publication

Gene expression databases

BgeeiENSG00000102078
CleanExiHS_SLC25A14
ExpressionAtlasiO95258 baseline and differential
GenevisibleiO95258 HS

Organism-specific databases

HPAiHPA060316

Interactioni

Protein-protein interaction databases

BioGridi114485, 9 interactors
STRINGi9606.ENSP00000218197

Structurei

3D structure databases

ProteinModelPortaliO95258
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati42 – 131Solcar 1Add BLAST90
Repeati139 – 224Solcar 2Add BLAST86
Repeati233 – 323Solcar 3Add BLAST91

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0753 Eukaryota
ENOG410XRV1 LUCA
GeneTreeiENSGT00760000119170
HOGENOMiHOG000165140
HOVERGENiHBG009528
InParanoidiO95258
KOiK15106
OMAiDQVANHF
OrthoDBiEOG091G0BQ7
PhylomeDBiO95258
TreeFamiTF323211

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR002030 Mit_uncoupling_UCP-like
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
IPR032933 SLC25A14
PANTHERiPTHR24089:SF299 PTHR24089:SF299, 1 hit
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
PRINTSiPR00784 MTUNCOUPLING
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O95258-1) [UniParc]FASTAAdd to basket
Also known as: UCP5L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGIFPGIILI FLRVKFATAA VIVSGHQKST TVSHEMSGLN WKPFVYGGLA
60 70 80 90 100
SIVAEFGTFP VDLTKTRLQV QGQSIDARFK EIKYRGMFHA LFRICKEEGV
110 120 130 140 150
LALYSGIAPA LLRQASYGTI KIGIYQSLKR LFVERLEDET LLINMICGVV
160 170 180 190 200
SGVISSTIAN PTDVLKIRMQ AQGSLFQGSM IGSFIDIYQQ EGTRGLWRGV
210 220 230 240 250
VPTAQRAAIV VGVELPVYDI TKKHLILSGM MGDTILTHFV SSFTCGLAGA
260 270 280 290 300
LASNPVDVVR TRMMNQRAIV GHVDLYKGTV DGILKMWKHE GFFALYKGFW
310 320
PNWLRLGPWN IIFFITYEQL KRLQI
Length:325
Mass (Da):36,202
Last modified:May 1, 1999 - v1
Checksum:i0447E8E3B5374982
GO
Isoform 2 (identifier: O95258-2) [UniParc]FASTAAdd to basket
Also known as: UCP5S

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.

Show »
Length:322
Mass (Da):35,958
Checksum:iF3C186B06ADC0F6A
GO
Isoform 3 (identifier: O95258-3) [UniParc]FASTAAdd to basket
Also known as: UCP5SI

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.
     198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE

Show »
Length:353
Mass (Da):39,173
Checksum:i8A66113E6FAE9C7B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05013855E → A. Corresponds to variant dbSNP:rs2143598Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00327223 – 25Missing in isoform 2 and isoform 3. Curated3
Alternative sequenceiVSP_003273198R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF078544 mRNA Translation: AAD04346.1
AF155809 mRNA Translation: AAG29582.1
AF155810 mRNA Translation: AAG29583.1
AF155811 mRNA Translation: AAG29584.1
AY358099 mRNA Translation: AAQ88466.1
AL035423 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11804.1
BC119666 mRNA Translation: AAI19667.1
BC119667 mRNA Translation: AAI19668.1
CCDSiCCDS14623.1 [O95258-1]
CCDS14624.1 [O95258-2]
CCDS76020.1 [O95258-3]
RefSeqiNP_001269124.1, NM_001282195.1 [O95258-1]
NP_001269125.1, NM_001282196.1 [O95258-2]
NP_001269126.1, NM_001282197.1 [O95258-3]
NP_001269127.1, NM_001282198.1
UniGeneiHs.194686

Genome annotation databases

EnsembliENST00000218197; ENSP00000218197; ENSG00000102078 [O95258-1]
ENST00000339231; ENSP00000342797; ENSG00000102078 [O95258-3]
ENST00000361980; ENSP00000354455; ENSG00000102078 [O95258-2]
ENST00000545805; ENSP00000444642; ENSG00000102078 [O95258-1]
ENST00000612248; ENSP00000477981; ENSG00000102078 [O95258-3]
GeneIDi9016
KEGGihsa:9016
UCSCiuc004evp.3 human [O95258-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiUCP5_HUMAN
AccessioniPrimary (citable) accession number: O95258
Secondary accession number(s): D3DTG2
, Q0VDH7, Q9HC60, Q9HC61
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: July 18, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health