Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O95258 (UCP5_HUMAN)

Entry version 176 (02 Dec 2020)
Sequence version 1 (01 May 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Brain mitochondrial carrier protein 1

Gene

SLC25A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the mitochondrial proton leak measured in brain mitochondria.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O95258

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-167826, The fatty acid cycling model
R-HSA-167827, The proton buffering model

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.29.24.1, the mitochondrial carrier (mc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Brain mitochondrial carrier protein 1
Short name:
BMCP-1
Alternative name(s):
Mitochondrial uncoupling protein 5
Short name:
UCP 5
Solute carrier family 25 member 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC25A14
Synonyms:BMCP1, UCP5
ORF Names:UNQ791/PRO1682
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000102078.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:10984, SLC25A14

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300242, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O95258

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei38 – 54Helical; Name=1Sequence analysisAdd BLAST17
Transmembranei112 – 128Helical; Name=2Sequence analysisAdd BLAST17
Transmembranei141 – 161Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei199 – 215Helical; Name=4Sequence analysisAdd BLAST17
Transmembranei240 – 256Helical; Name=5Sequence analysisAdd BLAST17
Transmembranei298 – 315Helical; Name=6Sequence analysisAdd BLAST18

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9016

Open Targets

More...OpenTargetsi		ENSG00000102078

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35860

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O95258, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC25A14

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000906771 – 325Brain mitochondrial carrier protein 1Add BLAST325

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O95258

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O95258

MaxQB - The MaxQuant DataBase

More...MaxQBi		O95258

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O95258

PeptideAtlas

More...PeptideAtlasi		O95258

PRoteomics IDEntifications database

More...PRIDEi		O95258

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		50752 [O95258-1]
50753 [O95258-2]
50754 [O95258-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O95258

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O95258

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in brain. Some expression in testis and pituitary.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000102078, Expressed in secondary oocyte and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O95258, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O95258, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000102078, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114485, 10 interactors

Protein interaction database and analysis system

More...IntActi		O95258, 7 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000477981

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O95258, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati42 – 131Solcar 1Add BLAST90
Repeati139 – 224Solcar 2Add BLAST86
Repeati233 – 323Solcar 3Add BLAST91

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0753, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159471

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O95258

Identification of Orthologs from Complete Genome Data

More...OMAi		DQVANHF

Database for complete collections of gene phylogenies

More...PhylomeDBi		O95258

TreeFam database of animal gene trees

More...TreeFami		TF323211

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.50.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002030, Mit_uncoupling_UCP-like
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf
IPR032933, SLC25A14

The PANTHER Classification System

More...PANTHERi		PTHR45618:SF20, PTHR45618:SF20, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00153, Mito_carr, 3 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00784, MTUNCOUPLING

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF103506, SSF103506, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50920, SOLCAR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95258-1) [UniParc]FASTAAdd to basket
Also known as: UCP5L

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGIFPGIILI FLRVKFATAA VIVSGHQKST TVSHEMSGLN WKPFVYGGLA 
        60         70         80         90        100
SIVAEFGTFP VDLTKTRLQV QGQSIDARFK EIKYRGMFHA LFRICKEEGV 
       110        120        130        140        150
LALYSGIAPA LLRQASYGTI KIGIYQSLKR LFVERLEDET LLINMICGVV 
       160        170        180        190        200
SGVISSTIAN PTDVLKIRMQ AQGSLFQGSM IGSFIDIYQQ EGTRGLWRGV 
       210        220        230        240        250
VPTAQRAAIV VGVELPVYDI TKKHLILSGM MGDTILTHFV SSFTCGLAGA 
       260        270        280        290        300
LASNPVDVVR TRMMNQRAIV GHVDLYKGTV DGILKMWKHE GFFALYKGFW 
       310        320 
PNWLRLGPWN IIFFITYEQL KRLQI
Length:325
Mass (Da):36,202
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0447E8E3B5374982
GO
Isoform 2 (identifier: O95258-2) [UniParc]FASTAAdd to basket
Also known as: UCP5S

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.

Show »
Length:322
Mass (Da):35,958
Checksum:iF3C186B06ADC0F6A
GO
Isoform 3 (identifier: O95258-3) [UniParc]FASTAAdd to basket
Also known as: UCP5SI

The sequence of this isoform differs from the canonical sequence as follows:
     23-25: Missing.
     198-198: R → RCLCSKAVTGCVLWLMPVIPALWEANAGGSLE

Show »
Length:353
Mass (Da):39,173
Checksum:i8A66113E6FAE9C7B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JY88Q5JY88_HUMAN
Brain mitochondrial carrier protein...
SLC25A14
198Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6SL11F6SL11_HUMAN
Brain mitochondrial carrier protein...
SLC25A14
290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05013855E → A. Corresponds to variant dbSNP:rs2143598Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00327223 – 25Missing in isoform 2 and isoform 3. Curated3
Alternative sequenceiVSP_003273198R → RCLCSKAVTGCVLWLMPVIP ALWEANAGGSLE in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF078544 mRNA Translation: AAD04346.1
AF155809 mRNA Translation: AAG29582.1
AF155810 mRNA Translation: AAG29583.1
AF155811 mRNA Translation: AAG29584.1
AY358099 mRNA Translation: AAQ88466.1
AL035423 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11804.1
BC119666 mRNA Translation: AAI19667.1
BC119667 mRNA Translation: AAI19668.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14623.1 [O95258-1]
CCDS14624.1 [O95258-2]
CCDS76020.1 [O95258-3]

NCBI Reference Sequences

More...RefSeqi		NP_001269124.1, NM_001282195.1 [O95258-1]
NP_001269125.1, NM_001282196.1 [O95258-2]
NP_001269126.1, NM_001282197.1 [O95258-3]
NP_001269127.1, NM_001282198.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000218197; ENSP00000218197; ENSG00000102078 [O95258-1]
ENST00000339231; ENSP00000342797; ENSG00000102078 [O95258-3]
ENST00000361980; ENSP00000354455; ENSG00000102078 [O95258-2]
ENST00000545805; ENSP00000444642; ENSG00000102078 [O95258-1]
ENST00000612248; ENSP00000477981; ENSG00000102078 [O95258-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9016

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9016

UCSC genome browser

More...UCSCi		uc004evp.3, human [O95258-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF078544 mRNA Translation: AAD04346.1
AF155809 mRNA Translation: AAG29582.1
AF155810 mRNA Translation: AAG29583.1
AF155811 mRNA Translation: AAG29584.1
AY358099 mRNA Translation: AAQ88466.1
AL035423 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11804.1
BC119666 mRNA Translation: AAI19667.1
BC119667 mRNA Translation: AAI19668.1
CCDSiCCDS14623.1 [O95258-1]
CCDS14624.1 [O95258-2]
CCDS76020.1 [O95258-3]
RefSeqiNP_001269124.1, NM_001282195.1 [O95258-1]
NP_001269125.1, NM_001282196.1 [O95258-2]
NP_001269126.1, NM_001282197.1 [O95258-3]
NP_001269127.1, NM_001282198.1

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi114485, 10 interactors
IntActiO95258, 7 interactors
STRINGi9606.ENSP00000477981

Protein family/group databases

TCDBi2.A.29.24.1, the mitochondrial carrier (mc) family

PTM databases

iPTMnetiO95258
PhosphoSitePlusiO95258

Polymorphism and mutation databases

BioMutaiSLC25A14

Proteomic databases

jPOSTiO95258
MassIVEiO95258
MaxQBiO95258
PaxDbiO95258
PeptideAtlasiO95258
PRIDEiO95258
ProteomicsDBi50752 [O95258-1]
50753 [O95258-2]
50754 [O95258-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16263, 84 antibodies

Genome annotation databases

EnsembliENST00000218197; ENSP00000218197; ENSG00000102078 [O95258-1]
ENST00000339231; ENSP00000342797; ENSG00000102078 [O95258-3]
ENST00000361980; ENSP00000354455; ENSG00000102078 [O95258-2]
ENST00000545805; ENSP00000444642; ENSG00000102078 [O95258-1]
ENST00000612248; ENSP00000477981; ENSG00000102078 [O95258-3]
GeneIDi9016
KEGGihsa:9016
UCSCiuc004evp.3, human [O95258-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9016
DisGeNETi9016
EuPathDBiHostDB:ENSG00000102078.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC25A14
HGNCiHGNC:10984, SLC25A14
HPAiENSG00000102078, Low tissue specificity
MIMi300242, gene
neXtProtiNX_O95258
OpenTargetsiENSG00000102078
PharmGKBiPA35860

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0753, Eukaryota
GeneTreeiENSGT00940000159471
InParanoidiO95258
OMAiDQVANHF
PhylomeDBiO95258
TreeFamiTF323211

Enzyme and pathway databases

PathwayCommonsiO95258
ReactomeiR-HSA-167826, The fatty acid cycling model
R-HSA-167827, The proton buffering model

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9016, 4 hits in 470 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC25A14, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SLC25A14

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9016
PharosiO95258, Tbio

Protein Ontology

More...PROi		PR:O95258
RNActiO95258, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000102078, Expressed in secondary oocyte and 225 other tissues
ExpressionAtlasiO95258, baseline and differential
GenevisibleiO95258, HS

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR002030, Mit_uncoupling_UCP-like
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf
IPR032933, SLC25A14
PANTHERiPTHR45618:SF20, PTHR45618:SF20, 1 hit
PfamiView protein in Pfam
PF00153, Mito_carr, 3 hits
PRINTSiPR00784, MTUNCOUPLING
SUPFAMiSSF103506, SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920, SOLCAR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUCP5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95258
Secondary accession number(s): D3DTG2
, Q0VDH7, Q9HC60, Q9HC61
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1999
Last modified: December 2, 2020
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again