Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Reticulon-3

Gene

RTN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. Induces the formation of endoplasmic reticulum tubules (PubMed:25612671).5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • endoplasmic reticulum tubular network formation Source: UniProtKB
  • endoplasmic reticulum tubular network organization Source: UniProtKB
  • vesicle-mediated transport Source: UniProtKB-KW
  • viral process Source: UniProtKB-KW

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, ER-Golgi transport, Host-virus interaction, Stress response, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8849932 Synaptic adhesion-like molecules

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Reticulon-3
Alternative name(s):
Homolog of ASY protein
Short name:
HAP
Neuroendocrine-specific protein-like 2
Short name:
NSP-like protein 2
Neuroendocrine-specific protein-like II
Short name:
NSP-like protein II
Short name:
NSPLII
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RTN3
Synonyms:ASYIP, NSPL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000133318.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10469 RTN3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604249 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95197

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 863CytoplasmicSequence analysisAdd BLAST862
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei864 – 887HelicalSequence analysisAdd BLAST24
Topological domaini888 – 947CytoplasmicSequence analysisAdd BLAST60
Intramembranei948 – 968HelicalSequence analysisAdd BLAST21
Topological domaini969 – 972CytoplasmicSequence analysis4
Intramembranei973 – 993HelicalSequence analysisAdd BLAST21
Topological domaini994 – 1032CytoplasmicSequence analysisAdd BLAST39

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10313

Open Targets

More...
OpenTargetsi
ENSG00000133318

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34882

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RTN3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001681632 – 1032Reticulon-3Add BLAST1031

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei30PhosphoserineCombined sources1
Modified residuei229PhosphoserineCombined sources1
Modified residuei243PhosphoserineBy similarity1
Modified residuei246PhosphoserineCombined sources1
Modified residuei283PhosphoserineBy similarity1
Modified residuei316PhosphoserineCombined sources1
Modified residuei453PhosphoserineCombined sources1
Modified residuei649PhosphoserineCombined sources1
Modified residuei650PhosphoserineCombined sources1
Modified residuei735PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95197

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95197

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95197

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95197

PeptideAtlas

More...
PeptideAtlasi
O95197

PRoteomics IDEntifications database

More...
PRIDEi
O95197

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50700
50701 [O95197-2]
50702 [O95197-3]
50703 [O95197-4]
50704 [O95197-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O95197-2 [O95197-2]
O95197-3 [O95197-3]
O95197-4 [O95197-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95197

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95197

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O95197

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 3 is widely expressed, with highest levels in brain, where it is enriched in neuronal cell bodies from gray matter (at protein level). Three times more abundant in macula than in peripheral retina. Isoform 1 is expressed at high levels in brain and at low levels in skeletal muscle. Isoform 2 is only found in melanoma.5 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By endoplasmic reticulum stress (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133318 Expressed in 103 organ(s), highest expression level in hypothalamus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95197 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95197 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015649
HPA015650

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with ATL1 (By similarity). Interacts with RTN4. Isoform 3 interacts with BACE1, BACE2, BCL2 and FADD. Interacts with ATL2. Interacts with TMEM33 (By similarity). Interacts with ZFYVE27 and with KIF5A in a ZFYVE27-dependent manner (PubMed:21976701).By similarity8 Publications
(Microbial infection) Interacts with Coxsackievirus A16, enterovirus 71 and poliovirus P2C proteins (PubMed:17182608).2 Publications
(Microbial infection) Interacts with West Nile virus protein NS4A.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115598, 33 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O95197

Protein interaction database and analysis system

More...
IntActi
O95197, 33 interactors

Molecular INTeraction database

More...
MINTi
O95197

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000344106

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95197

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95197

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini844 – 1032ReticulonPROSITE-ProRule annotationAdd BLAST189

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni987 – 1032Interaction with FADD1 PublicationAdd BLAST46
Regioni1000 – 1002Interaction with BACE13

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1792 Eukaryota
ENOG410XPKH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157482

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG093922

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95197

KEGG Orthology (KO)

More...
KOi
K20723

Identification of Orthologs from Complete Genome Data

More...
OMAi
IAHDIAI

Database of Orthologous Groups

More...
OrthoDBi
423549at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95197

TreeFam database of animal gene trees

More...
TreeFami
TF105431

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003388 Reticulon

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02453 Reticulon, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50845 RETICULON, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95197-1) [UniParc]FASTAAdd to basket
Also known as: A1, A4b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEPSAATQS HSISSSSFGA EPSAPGGGGS PGACPALGTK SCSSSCADSF
60 70 80 90 100
VSSSSSQPVS LFSTSQEGLS SLCSDEPSSE IMTSSFLSSS EIHNTGLTIL
110 120 130 140 150
HGEKSHVLGS QPILAKEGKD HLDLLDMKKM EKPQGTSNNV SDSSVSLAAG
160 170 180 190 200
VHCDRPSIPA SFPEHPAFLS KKIGQVEEQI DKETKNPNGV SSREAKTALD
210 220 230 240 250
ADDRFTLLTA QKPPTEYSKV EGIYTYSLSP SKVSGDDVIE KDSPESPFEV
260 270 280 290 300
IIDKAAFDKE FKDSYKESTD DFGSWSVHTD KESSEDISET NDKLFPLRNK
310 320 330 340 350
EAGRYPMSAL LSRQFSHTNA ALEEVSRCVN DMHNFTNEIL TWDLVPQVKQ
360 370 380 390 400
QTDKSSDCIT KTTGLDMSEY NSEIPVVNLK TSTHQKTPVC SIDGSTPITK
410 420 430 440 450
STGDWAEASL QQENAITGKP VPDSLNSTKE FSIKGVQGNM QKQDDTLAEL
460 470 480 490 500
PGSPPEKCDS LGSGVATVKV VLPDDHLKDE MDWQSSALGE ITEADSSGES
510 520 530 540 550
DDTVIEDITA DTSFENNKIQ AEKPVSIPSA VVKTGEREIK EIPSCEREEK
560 570 580 590 600
TSKNFEELVS DSELHQDQPD ILGRSPASEA ACSKVPDTNV SLEDVSEVAP
610 620 630 640 650
EKPITTENPK LPSTVSPNVF NETEFSLNVT TSAYLESLHG KNVKHIDDSS
660 670 680 690 700
PEDLIAAFTE TRDKGIVDSE RNAFKAISEK MTDFKTTPPV EVLHENESGG
710 720 730 740 750
SEIKDIGSKY SEQSKETNGS EPLGVFPTQG TPVASLDLEQ EQLTIKALKE
760 770 780 790 800
LGERQVEKST SAQRDAELPS EEVLKQTFTF APESWPQRSY DILERNVKNG
810 820 830 840 850
SDLGISQKPI TIRETTRVDA VSSLSKTELV KKHVLARLLT DFSVHDLIFW
860 870 880 890 900
RDVKKTGFVF GTTLIMLLSL AAFSVISVVS YLILALLSVT ISFRIYKSVI
910 920 930 940 950
QAVQKSEEGH PFKAYLDVDI TLSSEAFHNY MNAAMVHINR ALKLIIRLFL
960 970 980 990 1000
VEDLVDSLKL AVFMWLMTYV GAVFNGITLL ILAELLIFSV PIVYEKYKTQ
1010 1020 1030
IDHYVGIARD QTKSIVEKIQ AKLPGIAKKK AE
Length:1,032
Mass (Da):112,611
Last modified:March 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i26B372B82BFC6361
GO
Isoform 2 (identifier: O95197-2) [UniParc]FASTAAdd to basket
Also known as: A2, A3b

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.

Show »
Length:1,013
Mass (Da):110,652
Checksum:i26EBCFC7BF6351FC
GO
Isoform 3 (identifier: O95197-3) [UniParc]FASTAAdd to basket
Also known as: B1, A1

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.
     67-843: Missing.

Show »
Length:236
Mass (Da):25,609
Checksum:iDDC6A4544ABCDFB7
GO
Isoform 4 (identifier: O95197-4) [UniParc]FASTAAdd to basket
Also known as: B2, A2

The sequence of this isoform differs from the canonical sequence as follows:
     67-843: Missing.

Show »
Length:255
Mass (Da):27,568
Checksum:iA1EB93C4659AD832
GO
Isoform 5 (identifier: O95197-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-66: Missing.
     67-843: Missing.
     999-1032: TQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE → DPSKTPWNRQKKGRISTWKPEMQQLLKHHLIVITSLLVL

Note: No experimental confirmation available.
Show »
Length:241
Mass (Da):26,452
Checksum:i12919C71F2208160
GO
Isoform 6 (identifier: O95197-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-843: Missing.
     914-1032: AYLDVDITLS...LPGIAKKKAE → PRLITMLASP...PQYQAQKLMD

Show »
Length:214
Mass (Da):23,489
Checksum:iD066FBEA9D48E49C
GO
Isoform 7 (identifier: O95197-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-159: Missing.

Note: Gene prediction based on EST data.
Show »
Length:920
Mass (Da):100,824
Checksum:i5C36B72E4243492C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z4M1B7Z4M1_HUMAN
Reticulon
RTN3 hCG_1775344
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H617F5H617_HUMAN
Reticulon
RTN3
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H891F5H891_HUMAN
Reticulon-3
RTN3
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GWG7F5GWG7_HUMAN
Reticulon-3
RTN3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD93008 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti871A → V in BAD93008 (PubMed:15946766).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0311646A → E1 PublicationCorresponds to variant dbSNP:rs11551944Ensembl.1
Natural variantiVAR_057713501D → H. Corresponds to variant dbSNP:rs7936660Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04531948 – 843Missing in isoform 6. 1 PublicationAdd BLAST796
Alternative sequenceiVSP_04700848 – 159Missing in isoform 7. CuratedAdd BLAST112
Alternative sequenceiVSP_02375948 – 66Missing in isoform 2, isoform 3 and isoform 5. 7 PublicationsAdd BLAST19
Alternative sequenceiVSP_02376067 – 843Missing in isoform 3, isoform 4 and isoform 5. 7 PublicationsAdd BLAST777
Alternative sequenceiVSP_045320914 – 1032AYLDV…KKKAE → PRLITMLASPEIRPSQLLKR SKQNSLESPKKRQNKYMETR NATVTKTPFNSYNVVTCTMK ENTQCQLEPAFQAFFLIWCF LPSFPFNPQYQAQKLMD in isoform 6. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_023761999 – 1032TQIDH…KKKAE → DPSKTPWNRQKKGRISTWKP EMQQLLKHHLIVITSLLVL in isoform 5. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF059524 mRNA Translation: AAC99319.1
AF059529
, AF059525, AF059526, AF059527, AF059528 Genomic DNA Translation: AAD20951.1
AF119297 mRNA Translation: AAD26810.1
AY427821 mRNA Translation: AAR02474.1
AY750848 mRNA Translation: AAU81930.1
AP000753 Genomic DNA No translation available.
AP006289 Genomic DNA No translation available.
AK297529 mRNA Translation: BAH12606.1
AB209771 mRNA Translation: BAD93008.1 Different initiation.
AK075412 mRNA Translation: BAG52134.1
AK222898 mRNA Translation: BAD96618.1
AK295361 mRNA Translation: BAH12044.1
CH471076 Genomic DNA Translation: EAW74170.1
BC000634 mRNA Translation: AAH00634.1
BC010556 mRNA Translation: AAH10556.1
BC011394 mRNA Translation: AAH11394.1
BC022993 mRNA Translation: AAH22993.1
BC100822 mRNA Translation: AAI00823.1
BC100823 mRNA Translation: AAI00824.1
BC105981 mRNA Translation: AAI05982.1
BC105982 mRNA Translation: AAI05983.1
BC118628 mRNA Translation: AAI18629.1
BC118550 mRNA Translation: AAI18551.1
BK001685 mRNA Translation: DAA01931.1
BK001681 mRNA Translation: DAA01941.1
BK001684 mRNA Translation: DAA01943.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41664.1 [O95197-4]
CCDS58141.1 [O95197-1]
CCDS58142.1 [O95197-7]
CCDS58143.1 [O95197-6]
CCDS8048.1 [O95197-5]
CCDS8049.1 [O95197-3]
CCDS8050.1 [O95197-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001252518.1, NM_001265589.1 [O95197-1]
NP_001252519.1, NM_001265590.1 [O95197-7]
NP_001252520.1, NM_001265591.1 [O95197-6]
NP_006045.1, NM_006054.3 [O95197-3]
NP_958831.1, NM_201428.2 [O95197-2]
NP_958832.1, NM_201429.2 [O95197-4]
NP_958833.1, NM_201430.2 [O95197-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.743229

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339997; ENSP00000344106; ENSG00000133318 [O95197-2]
ENST00000341307; ENSP00000340903; ENSG00000133318 [O95197-5]
ENST00000354497; ENSP00000346492; ENSG00000133318 [O95197-6]
ENST00000356000; ENSP00000348279; ENSG00000133318 [O95197-4]
ENST00000377819; ENSP00000367050; ENSG00000133318 [O95197-1]
ENST00000537981; ENSP00000440874; ENSG00000133318 [O95197-3]
ENST00000540798; ENSP00000442733; ENSG00000133318 [O95197-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10313

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10313

UCSC genome browser

More...
UCSCi
uc001nxm.3 human [O95197-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059524 mRNA Translation: AAC99319.1
AF059529
, AF059525, AF059526, AF059527, AF059528 Genomic DNA Translation: AAD20951.1
AF119297 mRNA Translation: AAD26810.1
AY427821 mRNA Translation: AAR02474.1
AY750848 mRNA Translation: AAU81930.1
AP000753 Genomic DNA No translation available.
AP006289 Genomic DNA No translation available.
AK297529 mRNA Translation: BAH12606.1
AB209771 mRNA Translation: BAD93008.1 Different initiation.
AK075412 mRNA Translation: BAG52134.1
AK222898 mRNA Translation: BAD96618.1
AK295361 mRNA Translation: BAH12044.1
CH471076 Genomic DNA Translation: EAW74170.1
BC000634 mRNA Translation: AAH00634.1
BC010556 mRNA Translation: AAH10556.1
BC011394 mRNA Translation: AAH11394.1
BC022993 mRNA Translation: AAH22993.1
BC100822 mRNA Translation: AAI00823.1
BC100823 mRNA Translation: AAI00824.1
BC105981 mRNA Translation: AAI05982.1
BC105982 mRNA Translation: AAI05983.1
BC118628 mRNA Translation: AAI18629.1
BC118550 mRNA Translation: AAI18551.1
BK001685 mRNA Translation: DAA01931.1
BK001681 mRNA Translation: DAA01941.1
BK001684 mRNA Translation: DAA01943.1
CCDSiCCDS41664.1 [O95197-4]
CCDS58141.1 [O95197-1]
CCDS58142.1 [O95197-7]
CCDS58143.1 [O95197-6]
CCDS8048.1 [O95197-5]
CCDS8049.1 [O95197-3]
CCDS8050.1 [O95197-2]
RefSeqiNP_001252518.1, NM_001265589.1 [O95197-1]
NP_001252519.1, NM_001265590.1 [O95197-7]
NP_001252520.1, NM_001265591.1 [O95197-6]
NP_006045.1, NM_006054.3 [O95197-3]
NP_958831.1, NM_201428.2 [O95197-2]
NP_958832.1, NM_201429.2 [O95197-4]
NP_958833.1, NM_201430.2 [O95197-5]
UniGeneiHs.743229

3D structure databases

ProteinModelPortaliO95197
SMRiO95197
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115598, 33 interactors
CORUMiO95197
IntActiO95197, 33 interactors
MINTiO95197
STRINGi9606.ENSP00000344106

PTM databases

iPTMnetiO95197
PhosphoSitePlusiO95197
SwissPalmiO95197

Polymorphism and mutation databases

BioMutaiRTN3

Proteomic databases

EPDiO95197
jPOSTiO95197
MaxQBiO95197
PaxDbiO95197
PeptideAtlasiO95197
PRIDEiO95197
ProteomicsDBi50700
50701 [O95197-2]
50702 [O95197-3]
50703 [O95197-4]
50704 [O95197-5]
TopDownProteomicsiO95197-2 [O95197-2]
O95197-3 [O95197-3]
O95197-4 [O95197-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10313
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339997; ENSP00000344106; ENSG00000133318 [O95197-2]
ENST00000341307; ENSP00000340903; ENSG00000133318 [O95197-5]
ENST00000354497; ENSP00000346492; ENSG00000133318 [O95197-6]
ENST00000356000; ENSP00000348279; ENSG00000133318 [O95197-4]
ENST00000377819; ENSP00000367050; ENSG00000133318 [O95197-1]
ENST00000537981; ENSP00000440874; ENSG00000133318 [O95197-3]
ENST00000540798; ENSP00000442733; ENSG00000133318 [O95197-7]
GeneIDi10313
KEGGihsa:10313
UCSCiuc001nxm.3 human [O95197-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10313
DisGeNETi10313
EuPathDBiHostDB:ENSG00000133318.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RTN3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0021346
HGNCiHGNC:10469 RTN3
HPAiHPA015649
HPA015650
MIMi604249 gene
neXtProtiNX_O95197
OpenTargetsiENSG00000133318
PharmGKBiPA34882

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1792 Eukaryota
ENOG410XPKH LUCA
GeneTreeiENSGT00940000157482
HOVERGENiHBG093922
InParanoidiO95197
KOiK20723
OMAiIAHDIAI
OrthoDBi423549at2759
PhylomeDBiO95197
TreeFamiTF105431

Enzyme and pathway databases

ReactomeiR-HSA-8849932 Synaptic adhesion-like molecules

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RTN3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RTN3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10313

Protein Ontology

More...
PROi
PR:O95197

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000133318 Expressed in 103 organ(s), highest expression level in hypothalamus
ExpressionAtlasiO95197 baseline and differential
GenevisibleiO95197 HS

Family and domain databases

InterProiView protein in InterPro
IPR003388 Reticulon
PfamiView protein in Pfam
PF02453 Reticulon, 1 hit
PROSITEiView protein in PROSITE
PS50845 RETICULON, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRTN3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95197
Secondary accession number(s): B3KQS2
, B7Z308, B7Z4M0, F5H774, Q147U9, Q496K2, Q53GN3, Q59EP0, Q5UEP2, Q6T930, Q7RTM7, Q7RTM8, Q7RTN3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 20, 2007
Last modified: January 16, 2019
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again