Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin conjugation factor E4 B

Gene

UBE4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ubiquitin-protein ligase that probably functions as an E3 ligase in conjunction with specific E1 and E2 ligases (By similarity). May also function as an E4 ligase mediating the assembly of polyubiquitin chains on substrates ubiquitinated by another E3 ubiquitin ligase (By similarity). May regulate myosin assembly in striated muscles together with STUB1 and VCP/p97 by targeting myosin chaperone UNC45B for proteasomal degradation (PubMed:17369820).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.By similarity EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.By similarity
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATPase binding Source: Ensembl
  • ATP binding Source: Ensembl
  • enzyme binding Source: UniProtKB
  • ubiquitin-ubiquitin ligase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.3.2.B12 2681

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin conjugation factor E4 BCurated (EC:2.3.2.27By similarity)
Alternative name(s):
Homozygously deleted in neuroblastoma 1Imported
RING-type E3 ubiquitin transferase E4 B
Ubiquitin fusion degradation protein 2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBE4BImported
Synonyms:HDNB1Imported, KIAA0684Imported, UFD2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000130939.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12500 UBE4B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613565 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95155

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi109D → A: Abolishes cleavage by caspase-3 and caspase-7. 1 Publication1
Mutagenesisi121D → A: Abolishes cleavage by caspase-6. No effect on cleavage by granzyme B. 1 Publication1
Mutagenesisi123D → A: Abolishes cleavage by caspase-6 and granzyme B. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10277

Open Targets

More...
OpenTargetsi
ENSG00000130939

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37148

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBE4B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001949931 – 1302Ubiquitin conjugation factor E4 BAdd BLAST1302

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei31PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei88PhosphoserineCombined sources1
Modified residuei90PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei103PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei124PhosphoserineCombined sources1
Modified residuei238PhosphoserineCombined sources1
Modified residuei383PhosphoserineCombined sources1
Modified residuei803PhosphoserineCombined sources1
Modified residuei969PhosphoserineBy similarity1
Modified residuei1265PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved by caspases during apoptosis. Cleaved efficiently at Asp-123 by caspase-6 and granzyme B. Cleaved with approximately 10-fold less efficiency at Asp-109 by caspase-3 and caspase-7.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei109 – 110Cleavage; by caspase-3 and caspase-72
Sitei123 – 124Cleavage; by caspase-6 and granzyme B2

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O95155

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95155

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O95155

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95155

PeptideAtlas

More...
PeptideAtlasi
O95155

PRoteomics IDEntifications database

More...
PRIDEi
O95155

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50670
50671 [O95155-2]
50672 [O95155-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95155

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95155

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
O95155

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in differentiated myotubes (at protein level) (PubMed:17369820). Highest expression in ovary, testis, heart and skeletal muscle (PubMed:11802788). Expression is low in colon, thymus and peripheral blood leukocytes (PubMed:11802788). Almost undetectable in lung and spleen (PubMed:11802788).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000130939 Expressed in 234 organ(s), highest expression level in brain

CleanEx database of gene expression profiles

More...
CleanExi
HS_UBE4B

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95155 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95155 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019219

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with VCP/p97. Interacts with STUB1/CHIP and UNC45B.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115566, 83 interactors

Database of interacting proteins

More...
DIPi
DIP-40309N

Protein interaction database and analysis system

More...
IntActi
O95155, 11 interactors

Molecular INTeraction database

More...
MINTi
O95155

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000343001

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11302
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KRENMR-A1208-1302[»]
3L1XX-ray2.60A1208-1302[»]
3L1ZX-ray3.17B1208-1302[»]
5O75X-ray1.48A1226-1302[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95155

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95155

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O95155

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1227 – 1300U-boxAdd BLAST74

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The U-box domain is required for the ubiquitin protein ligase activity.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2042 Eukaryota
COG5113 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009300

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294109

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058129

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95155

KEGG Orthology (KO)

More...
KOi
K10597

Identification of Orthologs from Complete Genome Data

More...
OMAi
AMWNHEL

Database of Orthologous Groups

More...
OrthoDBi
194967at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95155

TreeFam database of animal gene trees

More...
TreeFami
TF300802

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019474 Ub_conjug_fac_E4_core
IPR003613 Ubox_domain
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04564 U-box, 1 hit
PF10408 Ufd2P_core, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00504 Ubox, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51698 U_BOX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95155-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEELSADEIR RRRLARLAGG QTSQPTTPLT SPQRENPPGP PIAASAPGPS
60 70 80 90 100
QSLGLNVHNM TPATSPIGAS GVAHRSQSSE GVSSLSSSPS NSLETQSQSL
110 120 130 140 150
SRSQSMDIDG VSCEKSMSQV DVDSGIENME VDENDRREKR SLSDKEPSSG
160 170 180 190 200
PEVSEEQALQ LVCKIFRVSW KDRDRDVIFL SSLSAQFKQN PKEVFSDFKD
210 220 230 240 250
LIGQILMEVL MMSTQTRDEN PFASLTATSQ PIAAAARSPD RNLLLNTGSN
260 270 280 290 300
PGTSPMFCSV ASFGASSLSS LYESSPAPTP SFWSSVPVMG PSLASPSRAA
310 320 330 340 350
SQLAVPSTPL SPHSAASGTA AGSQPSSPRY RPYTVTHPWA SSGVSILSSS
360 370 380 390 400
PSPPALASSP QAVPASSSRQ RPSSTGPPLP PASPSATSRR PSSLRISPSL
410 420 430 440 450
GASGGASNWD SYSDHFTIET CKETDMLNYL IECFDRVGIE EKKAPKMCSQ
460 470 480 490 500
PAVSQLLSNI RSQCISHTAL VLQGSLTQPR SLQQPSFLVP YMLCRNLPYG
510 520 530 540 550
FIQELVRTTH QDEEVFKQIF IPILQGLALA AKECSLDSDY FKYPLMALGE
560 570 580 590 600
LCETKFGKTH PVCNLVASLR LWLPKSLSPG CGRELQRLSY LGAFFSFSVF
610 620 630 640 650
AEDDVKVVEK YFSGPAITLE NTRVVSQSLQ HYLELGRQEL FKILHSILLN
660 670 680 690 700
GETREAALSY MAAVVNANMK KAQMQTDDRL VSTDGFMLNF LWVLQQLSTK
710 720 730 740 750
IKLETVDPTY IFHPRCRITL PNDETRVNAT MEDVNDWLTE LYGDQPPFSE
760 770 780 790 800
PKFPTECFFL TLHAHHLSIL PSCRRYIRRL RAIRELNRTV EDLKNNESQW
810 820 830 840 850
KDSPLATRHR EMLKRCKTQL KKLVRCKACA DAGLLDESFL RRCLNFYGLL
860 870 880 890 900
IQLLLRILDP AYPDITLPLN SDVPKVFAAL PEFYVEDVAE FLFFIVQYSP
910 920 930 940 950
QALYEPCTQD IVMFLVVMLC NQNYIRNPYL VAKLVEVMFM TNPAVQPRTQ
960 970 980 990 1000
KFFEMIENHP LSTKLLVPSL MKFYTDVEHT GATSEFYDKF TIRYHISTIF
1010 1020 1030 1040 1050
KSLWQNIAHH GTFMEEFNSG KQFVRYINML INDTTFLLDE SLESLKRIHE
1060 1070 1080 1090 1100
VQEEMKNKEQ WDQLPRDQQQ ARQSQLAQDE RVSRSYLALA TETVDMFHIL
1110 1120 1130 1140 1150
TKQVQKPFLR PELGPRLAAM LNFNLQQLCG PKCRDLKVEN PEKYGFEPKK
1160 1170 1180 1190 1200
LLDQLTDIYL QLDCARFAKA IADDQRSYSK ELFEEVISKM RKAGIKSTIA
1210 1220 1230 1240 1250
IEKFKLLAEK VEEIVAKNAR AEIDYSDAPD EFRDPLMDTL MTDPVRLPSG
1260 1270 1280 1290 1300
TIMDRSIILR HLLNSPTDPF NRQTLTESML EPVPELKEQI QAWMREKQNS

DH
Length:1,302
Mass (Da):146,185
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6BAA80984B03E43B
GO
Isoform 2 (identifier: O95155-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-398: Missing.

Show »
Length:1,173
Mass (Da):133,275
Checksum:iEBFE3FA2270B72B3
GO
Isoform 3 (identifier: O95155-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-116: Missing.
     270-398: Missing.
     1234-1234: D → GKWTH

Note: No experimental confirmation available.
Show »
Length:1,061
Mass (Da):121,820
Checksum:iB4A29F16FFB1BD46
GO
Isoform 4 (identifier: O95155-4) [UniParc]FASTAAdd to basket
Also known as: UFD2a-7/7a, UFD2A-III

The sequence of this isoform differs from the canonical sequence as follows:
     398-398: P → PSMYDNPFSFLFLALSGDSSDEEDEEEDDDDGDGDDEGGGGGDDFSCVQFGS

Note: Expressed exclusively in mature striated muscle cells.
Show »
Length:1,353
Mass (Da):151,561
Checksum:i7D1745FEBDEA5B7C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EP75K7EP75_HUMAN
Ubiquitin conjugation factor E4 B
UBE4B
276Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERA7K7ERA7_HUMAN
Ubiquitin conjugation factor E4 B
UBE4B
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AQ61B1AQ61_HUMAN
Ubiquitin conjugation factor E4 B
UBE4B
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31659 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052437605V → I. Corresponds to variant dbSNP:rs17034499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0071011 – 116Missing in isoform 3. CuratedAdd BLAST116
Alternative sequenceiVSP_007102270 – 398Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST129
Alternative sequenceiVSP_053372398P → PSMYDNPFSFLFLALSGDSS DEEDEEEDDDDGDGDDEGGG GGDDFSCVQFGS in isoform 4. 1 Publication1
Alternative sequenceiVSP_0071031234D → GKWTH in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF043117 mRNA Translation: AAD02233.1
AB028839 mRNA Translation: BAB40446.1
AF331520 mRNA Translation: AAK69622.1
JF289274 mRNA Translation: AEK06331.1
AB014584 mRNA Translation: BAA31659.3 Different initiation.
AK292444 mRNA Translation: BAF85133.1
AL096841 Genomic DNA No translation available.
AL590639 Genomic DNA No translation available.
BC093696 mRNA Translation: AAH93696.1
AF091093 mRNA Translation: AAC72962.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS110.1 [O95155-2]
CCDS41245.1 [O95155-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00358

NCBI Reference Sequences

More...
RefSeqi
NP_001099032.1, NM_001105562.2 [O95155-1]
NP_006039.2, NM_006048.4 [O95155-2]
XP_005263479.1, XM_005263422.1 [O95155-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.593974

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000253251; ENSP00000253251; ENSG00000130939 [O95155-2]
ENST00000343090; ENSP00000343001; ENSG00000130939 [O95155-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10277

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10277

UCSC genome browser

More...
UCSCi
uc001aqr.5 human [O95155-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF043117 mRNA Translation: AAD02233.1
AB028839 mRNA Translation: BAB40446.1
AF331520 mRNA Translation: AAK69622.1
JF289274 mRNA Translation: AEK06331.1
AB014584 mRNA Translation: BAA31659.3 Different initiation.
AK292444 mRNA Translation: BAF85133.1
AL096841 Genomic DNA No translation available.
AL590639 Genomic DNA No translation available.
BC093696 mRNA Translation: AAH93696.1
AF091093 mRNA Translation: AAC72962.1 Sequence problems.
CCDSiCCDS110.1 [O95155-2]
CCDS41245.1 [O95155-1]
PIRiT00358
RefSeqiNP_001099032.1, NM_001105562.2 [O95155-1]
NP_006039.2, NM_006048.4 [O95155-2]
XP_005263479.1, XM_005263422.1 [O95155-4]
UniGeneiHs.593974

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KRENMR-A1208-1302[»]
3L1XX-ray2.60A1208-1302[»]
3L1ZX-ray3.17B1208-1302[»]
5O75X-ray1.48A1226-1302[»]
ProteinModelPortaliO95155
SMRiO95155
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115566, 83 interactors
DIPiDIP-40309N
IntActiO95155, 11 interactors
MINTiO95155
STRINGi9606.ENSP00000343001

PTM databases

iPTMnetiO95155
PhosphoSitePlusiO95155

Polymorphism and mutation databases

BioMutaiUBE4B

Proteomic databases

EPDiO95155
jPOSTiO95155
MaxQBiO95155
PaxDbiO95155
PeptideAtlasiO95155
PRIDEiO95155
ProteomicsDBi50670
50671 [O95155-2]
50672 [O95155-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253251; ENSP00000253251; ENSG00000130939 [O95155-2]
ENST00000343090; ENSP00000343001; ENSG00000130939 [O95155-1]
GeneIDi10277
KEGGihsa:10277
UCSCiuc001aqr.5 human [O95155-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10277
DisGeNETi10277
EuPathDBiHostDB:ENSG00000130939.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBE4B
HGNCiHGNC:12500 UBE4B
HPAiHPA019219
MIMi613565 gene
neXtProtiNX_O95155
OpenTargetsiENSG00000130939
PharmGKBiPA37148

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2042 Eukaryota
COG5113 LUCA
GeneTreeiENSGT00390000009300
HOGENOMiHOG000294109
HOVERGENiHBG058129
InParanoidiO95155
KOiK10597
OMAiAMWNHEL
OrthoDBi194967at2759
PhylomeDBiO95155
TreeFamiTF300802

Enzyme and pathway databases

UniPathwayi
UPA00143

BRENDAi2.3.2.B12 2681

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBE4B human
EvolutionaryTraceiO95155

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UBE4B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10277
PMAP-CutDBiO95155

Protein Ontology

More...
PROi
PR:O95155

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000130939 Expressed in 234 organ(s), highest expression level in brain
CleanExiHS_UBE4B
ExpressionAtlasiO95155 baseline and differential
GenevisibleiO95155 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019474 Ub_conjug_fac_E4_core
IPR003613 Ubox_domain
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF04564 U-box, 1 hit
PF10408 Ufd2P_core, 1 hit
SMARTiView protein in SMART
SM00504 Ubox, 1 hit
PROSITEiView protein in PROSITE
PS51698 U_BOX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBE4B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95155
Secondary accession number(s): A8K8S9
, G0ZJH6, O75169, O95338, Q5SZ12, Q5SZ16, Q96QD4, Q9BYI7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: May 1, 1999
Last modified: January 16, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again