Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (08 May 2019)
Sequence version 2 (17 Apr 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Peripheral-type benzodiazepine receptor-associated protein 1

Gene

TSPOAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

PubMed:9915832 demonstrated interaction with TSPO but later PubMed:12435798 demonstrated in the rat ortholog that is not associated with TSPO in the brain.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peripheral-type benzodiazepine receptor-associated protein 1
Short name:
PRAX-1
Alternative name(s):
Peripheral benzodiazepine receptor-interacting protein
Short name:
PBR-IP
RIMS-binding protein 1
Short name:
RIM-BP1
TSPO-associated protein 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSPOAP1Imported
Synonyms:BZRAP1, KIAA0612, RBP1, RIMBP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16831 TSPOAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610764 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95153

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000005379

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394545

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TSPOAP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002213801 – 1857Peripheral-type benzodiazepine receptor-associated protein 1Add BLAST1857

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O95153

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95153

PeptideAtlas

More...
PeptideAtlasi
O95153

PRoteomics IDEntifications database

More...
PRIDEi
O95153

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50666
50667 [O95153-2]
50668 [O95153-3]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
O95153

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95153

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95153

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
O95153

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in brain, pituitary gland and thymus in adults. In adult brain, highest expression found in temporal lobe and the putamen, followed by amygdala, caudate nucleus, cerebral cortex, occipital and frontal lobe. A high expression level is also observed in fetal tissues like brain, heart, kidney and thymus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000005379 Expressed in 200 organ(s), highest expression level in right frontal lobe

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95153 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95153 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA024662
HPA025244

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RIMS1 and RIMS2 (By similarity). Interacts with TSPO.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
CACNA1AO005552EBI-5915931,EBI-766279

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114680, 21 interactors

Protein interaction database and analysis system

More...
IntActi
O95153, 5 interactors

Molecular INTeraction database

More...
MINTi
O95153

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000345824

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O95153

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95153

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini653 – 720SH3 1PROSITE-ProRule annotationAdd BLAST68
Domaini791 – 882Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST92
Domaini884 – 976Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST93
Domaini981 – 1081Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST101
Domaini1625 – 1693SH3 2PROSITE-ProRule annotationAdd BLAST69
Domaini1764 – 1831SH3 3PROSITE-ProRule annotationAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1071 – 1150Pro-richAdd BLAST80
Compositional biasi1262 – 1274Poly-GluAdd BLAST13
Compositional biasi1334 – 1346Poly-GluAdd BLAST13

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SH3 and proline-rich domain is required for the interaction with TSPO and the second SH3 domain mediates binding to a proline-rich motif in RIMS1 and RIMS2.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RIMBP family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3632 Eukaryota
ENOG410XZ8W LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183203

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000139176

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95153

KEGG Orthology (KO)

More...
KOi
K19922

Identification of Orthologs from Complete Genome Data

More...
OMAi
SWEPGWE

Database of Orthologous Groups

More...
OrthoDBi
102427at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95153

TreeFam database of animal gene trees

More...
TreeFami
TF316230

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 1 hit
cd12012 SH3_RIM-BP_2, 1 hit
cd12013 SH3_RIM-BP_3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR035753 RIM-BP_SH3_2
IPR035755 RIM-BP_SH3_3
IPR040325 RIMBP1/2/3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14234 PTHR14234, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07653 SH3_2, 2 hits
PF14604 SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 3 hits
SM00326 SH3, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 2 hits
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 3 hits
PS50002 SH3, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O95153-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQLTTLPRP GDPGAMEPWA LPTWHSWTPG RGGEPSSAAP SIADTPPAAL
60 70 80 90 100
QLQELRSEES SKPKGDGSSR PVGGTDPEGA EACLPSLGQQ ASSSGPACQR
110 120 130 140 150
PEDEEVEAFL KAKLNMSFGD RPNLELLRAL GELRQRCAIL KEENQMLRKS
160 170 180 190 200
SFPETEEKVR RLKRKNAELA VIAKRLEERA RKLQETNLRV VSAPLPRPGT
210 220 230 240 250
SLELCRKALA RQRARDLSET ASALLAKDKQ IAALQRECRE LQARLTLVGK
260 270 280 290 300
EGPQWLHVRD FDRLLRESQR EVLRLQRQIA LRNQRETLPL PPSWPPGPAL
310 320 330 340 350
QARAGAPAPG APGEATPQED ADNLPVILGE PEKEQRVQQL ESELSKKRKK
360 370 380 390 400
CESLEQEARK KQRRCEELEL QLRQAQNENA RLVEENSRLS GRATEKEQVE
410 420 430 440 450
WENAELRGQL LGVTQERDSA LRKSQGLQSK LESLEQVLKH MREVAQRRQQ
460 470 480 490 500
LEVEHEQARL SLREKQEEVR RLQQAQAEAQ REHEGAVQLL ESTLDSMQAR
510 520 530 540 550
VRELEEQCRS QTEQFSLLAQ ELQAFRLHPG PLDLLTSALD CGSLGDCPPP
560 570 580 590 600
PCCCSIPQPC RGSGPKDLDL PPGSPGRCTP KSSEPAPATL TGVPRRTAKK
610 620 630 640 650
AESLSNSSHS ESIHNSPKSC PTPEVDTASE VEELEADSVS LLPAAPEGSR
660 670 680 690 700
GGARIQVFLA RYSYNPFEGP NENPEAELPL TAGEYIYIYG NMDEDGFFEG
710 720 730 740 750
ELMDGRRGLV PSNFVERVSD DDLLTSLPPE LADLSHSSGP ELSFLSVGGG
760 770 780 790 800
GSSSGGQSSV GRSQPRPEEE DAGDELSLSP SPEGLGEPPA VPYPRRLVVL
810 820 830 840 850
KQLAHSVVLA WEPPPEQVEL HGFHICVNGE LRQALGPGAP PKAVLENLDL
860 870 880 890 900
WAGPLHISVQ ALTSRGSSDP LRCCLAVGAR AGVVPSQLRV HRLTATSAEI
910 920 930 940 950
TWVPGNSNLA HAIYLNGEEC PPASPSTYWA TFCHLRPGTP YQAQVEAQLP
960 970 980 990 1000
PQGPWEPGWE RLEQRAATLQ FTTLPAGPPD APLDVQIEPG PSPGILIISW
1010 1020 1030 1040 1050
LPVTIDAAGT SNGVRVTGYA IYADGQKIME VASPTAGSVL VELSQLQLLQ
1060 1070 1080 1090 1100
VCREVVVRTM SPHGESADSI PAPITPALAP ASLPARVSCP SPHPSPEARA
1110 1120 1130 1140 1150
PLASASPGPG DPSSPLQHPA PLGTQEPPGA PPASPSREMA KGSHEDPPAP
1160 1170 1180 1190 1200
CSQEEAGAAV LGTSEERTAS TSTLGEKDPG PAAPSLAKQE AEWTAGEACP
1210 1220 1230 1240 1250
ASSSTQGARA QQAPNTEMCQ GGDPGSGLRP RAEKEDTAEL GVHLVNSLVD
1260 1270 1280 1290 1300
HGRNSDLSDI QEEEEEEEEE EEEELGSRTC SFQKQVAGNS IRENGAKSQP
1310 1320 1330 1340 1350
DPFCETDSDE EILEQILELP LQQFCSKKLF SIPEEEEEEE EDEEEEKSGA
1360 1370 1380 1390 1400
GCSSRDPGPP EPALLGLGCD SGQPRRPGQC PLSPESSRAG DCLEDMPGLV
1410 1420 1430 1440 1450
GGSSRRRGGG SPEKPPSRRR PPDPREHCSR LLSNNGPQAS GRLGPTRERG
1460 1470 1480 1490 1500
GLPVIEGPRT GLEASGRGRL GPSRRCSRGR ALEPGLASCL SPKCLEISIE
1510 1520 1530 1540 1550
YDSEDEQEAG SGGISITSSC YPGDGEAWGT ATVGRPRGPP KANSGPKPYP
1560 1570 1580 1590 1600
RLPAWEKGEP ERRGRSATGR AKEPLSRATE TGEARGQDGS GRRGPQKRGV
1610 1620 1630 1640 1650
RVLRPSTAEL VPARSPSETL AYQHLPVRIF VALFDYDPVS MSPNPDAGEE
1660 1670 1680 1690 1700
ELPFREGQIL KVFGDKDADG FYQGEGGGRT GYIPCNMVAE VAVDSPAGRQ
1710 1720 1730 1740 1750
QLLQRGYLSP DILLEGSGNG PFVYSTAHTT GPPPKPRRSK KAESEGPAQP
1760 1770 1780 1790 1800
CPGPPKLVPS ADLKAPHSMV AAFDYNPQES SPNMDVEAEL PFRAGDVITV
1810 1820 1830 1840 1850
FGGMDDDGFY YGELNGQRGL VPSNFLEGPG PEAGGLDREP RTPQAESQRT

RRRRVQC
Note: No experimental confirmation available.
Length:1,857
Mass (Da):200,051
Last modified:April 17, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i594F850C95F9EE02
GO
Isoform 2 (identifier: O95153-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-250: Missing.

Note: No experimental confirmation available.
Show »
Length:1,797
Mass (Da):193,499
Checksum:i8FD6E4FE89AA091F
GO
Isoform 3 (identifier: O95153-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1849-1857: RTRRRRVQC → DWGCTTQGSPGPPGGPCTPSSGSAPRIERGEPQGRSEKVWGFFSKGKQLLRRLGSGKKE

Note: No experimental confirmation available.
Show »
Length:1,907
Mass (Da):205,050
Checksum:i5034E93B8DB0E907
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KT64J3KT64_HUMAN
Peripheral-type benzodiazepine rece...
TSPOAP1
980Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSY4J3KSY4_HUMAN
Peripheral-type benzodiazepine rece...
TSPOAP1
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGN5A0A0C4DGN5_HUMAN
Peripheral-type benzodiazepine rece...
TSPOAP1
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31587 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1525G → R in AAD11957 (PubMed:9915832).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017446514Q → R. Corresponds to variant dbSNP:rs2072145Ensembl.1
Natural variantiVAR_017447586A → T. Corresponds to variant dbSNP:rs2072147Ensembl.1
Natural variantiVAR_070193652G → R1 PublicationCorresponds to variant dbSNP:rs373894175Ensembl.1
Natural variantiVAR_031662817Q → R1 PublicationCorresponds to variant dbSNP:rs9913145Ensembl.1
Natural variantiVAR_031663851W → R1 PublicationCorresponds to variant dbSNP:rs9905604Ensembl.1
Natural variantiVAR_0174481118H → L1 PublicationCorresponds to variant dbSNP:rs3744099Ensembl.1
Natural variantiVAR_0174491140A → P1 PublicationCorresponds to variant dbSNP:rs2680704Ensembl.1
Natural variantiVAR_0174501253R → C. Corresponds to variant dbSNP:rs3744101Ensembl.1
Natural variantiVAR_0316641728H → R1 PublicationCorresponds to variant dbSNP:rs11079346Ensembl.1
Natural variantiVAR_0174511830G → E. Corresponds to variant dbSNP:rs2301868Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009204191 – 250Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0092051849 – 1857RTRRRRVQC → DWGCTTQGSPGPPGGPCTPS SGSAPRIERGEPQGRSEKVW GFFSKGKQLLRRLGSGKKE in isoform 3. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF039571 mRNA Translation: AAD11957.1
AB014512 mRNA Translation: BAA31587.2 Different initiation.
BC031401 mRNA Translation: AAH31401.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11605.1 [O95153-1]
CCDS45742.1 [O95153-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00391

NCBI Reference Sequences

More...
RefSeqi
NP_001248764.1, NM_001261835.1
NP_004749.2, NM_004758.3 [O95153-1]
NP_077729.1, NM_024418.2 [O95153-2]
XP_006722236.1, XM_006722173.2 [O95153-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268893; ENSP00000268893; ENSG00000005379 [O95153-2]
ENST00000343736; ENSP00000345824; ENSG00000005379 [O95153-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9256

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9256

UCSC genome browser

More...
UCSCi
uc002ivx.6 human [O95153-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF039571 mRNA Translation: AAD11957.1
AB014512 mRNA Translation: BAA31587.2 Different initiation.
BC031401 mRNA Translation: AAH31401.1
CCDSiCCDS11605.1 [O95153-1]
CCDS45742.1 [O95153-2]
PIRiT00391
RefSeqiNP_001248764.1, NM_001261835.1
NP_004749.2, NM_004758.3 [O95153-1]
NP_077729.1, NM_024418.2 [O95153-2]
XP_006722236.1, XM_006722173.2 [O95153-3]

3D structure databases

SMRiO95153
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114680, 21 interactors
IntActiO95153, 5 interactors
MINTiO95153
STRINGi9606.ENSP00000345824

Chemistry databases

BindingDBiO95153

PTM databases

CarbonylDBiO95153
iPTMnetiO95153
PhosphoSitePlusiO95153

Polymorphism and mutation databases

BioMutaiTSPOAP1

Proteomic databases

jPOSTiO95153
PaxDbiO95153
PeptideAtlasiO95153
PRIDEiO95153
ProteomicsDBi50666
50667 [O95153-2]
50668 [O95153-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268893; ENSP00000268893; ENSG00000005379 [O95153-2]
ENST00000343736; ENSP00000345824; ENSG00000005379 [O95153-1]
GeneIDi9256
KEGGihsa:9256
UCSCiuc002ivx.6 human [O95153-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9256

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TSPOAP1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0014027
HGNCiHGNC:16831 TSPOAP1
HPAiHPA024662
HPA025244
MIMi610764 gene
neXtProtiNX_O95153
OpenTargetsiENSG00000005379
PharmGKBiPA128394545

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3632 Eukaryota
ENOG410XZ8W LUCA
GeneTreeiENSGT00950000183203
HOGENOMiHOG000139176
InParanoidiO95153
KOiK19922
OMAiSWEPGWE
OrthoDBi102427at2759
PhylomeDBiO95153
TreeFamiTF316230

Enzyme and pathway databases

ReactomeiR-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TSPOAP1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9256
PMAP-CutDBiO95153

Protein Ontology

More...
PROi
PR:O95153

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000005379 Expressed in 200 organ(s), highest expression level in right frontal lobe
ExpressionAtlasiO95153 baseline and differential
GenevisibleiO95153 HS

Family and domain databases

CDDicd00063 FN3, 1 hit
cd12012 SH3_RIM-BP_2, 1 hit
cd12013 SH3_RIM-BP_3, 1 hit
Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR035753 RIM-BP_SH3_2
IPR035755 RIM-BP_SH3_3
IPR040325 RIMBP1/2/3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR14234 PTHR14234, 1 hit
PfamiView protein in Pfam
PF07653 SH3_2, 2 hits
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00326 SH3, 3 hits
SUPFAMiSSF49265 SSF49265, 2 hits
SSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50002 SH3, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIMB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95153
Secondary accession number(s): O75111, Q8N5W3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: April 17, 2007
Last modified: May 8, 2019
This is version 163 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again