Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (13 Feb 2019)
Sequence version 1 (01 May 1999)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uridine phosphorylase 2

Gene

UPP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

A conditional disulfide bridge can form within the protein that dislocates a critical phosphate-coordinating arginine Arg-100 away from the active site, disabling the enzyme.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: UMP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes uracil from uridine (phosphorylase route).
Proteins known to be involved in this subpathway in this organism are:
  1. Uridine phosphorylase (UPP2), Uridine phosphorylase (UPP2), Uridine phosphorylase 1 (UPP1), Uridine phosphorylase 2 (UPP2)
This subpathway is part of the pathway UMP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes uracil from uridine (phosphorylase route), the pathway UMP biosynthesis via salvage pathway and in Pyrimidine metabolism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: IntAct
  • uridine phosphorylase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.2.3 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-73614 Pyrimidine salvage
R-HSA-73621 Pyrimidine catabolism

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
O95045

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O95045

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00574;UER00633

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uridine phosphorylase 2 (EC:2.4.2.3)
Short name:
UPase 2
Short name:
UrdPase 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UPP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000007001.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23061 UPP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617340 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O95045

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
151531

Open Targets

More...
OpenTargetsi
ENSG00000007001

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134866434

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00544 Fluorouracil
DB05041 RP101

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UPP2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000631931 – 317Uridine phosphorylase 2Add BLAST317

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi95 ↔ 102Redox-active1 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O95045

PeptideAtlas

More...
PeptideAtlasi
O95045

PRoteomics IDEntifications database

More...
PRIDEi
O95045

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50627
50628 [O95045-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O95045

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O95045

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000007001 Expressed in 57 organ(s), highest expression level in kidney epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O95045 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O95045 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035225
HPA035226

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127387, 5 interactors

Protein interaction database and analysis system

More...
IntActi
O95045, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387230

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1317
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XRFX-ray2.30A/B/C23-317[»]
3P0EX-ray2.00A/B/C/D/E/F21-314[»]
3P0FX-ray1.54A21-314[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O95045

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O95045

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O95045

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PNP/UDP phosphorylase family.Curated

Keywords - Domaini

Redox-active center

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3728 Eukaryota
COG2820 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161094

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231747

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG047725

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O95045

KEGG Orthology (KO)

More...
KOi
K00757

Identification of Orthologs from Complete Genome Data

More...
OMAi
FSYRYSM

Database of Orthologous Groups

More...
OrthoDBi
1423938at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O95045

TreeFam database of animal gene trees

More...
TreeFami
TF314310

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018016 Nucleoside_phosphorylase_CS
IPR000845 Nucleoside_phosphorylase_d
IPR035994 Nucleoside_phosphorylase_sf
IPR010059 Uridine_phosphorylase_euk

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01048 PNP_UDP_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53167 SSF53167, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01719 euk_UDPppase, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01232 PNP_UDP_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O95045-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASVIPASNR SMRSDRNTYV GKRFVHVKNP YLDLMDEDIL YHLDLGTKTH
60 70 80 90 100
NLPAMFGDVK FVCVGGSPNR MKAFALFMHK ELGFEEAEED IKDICAGTDR
110 120 130 140 150
YCMYKTGPVL AISHGMGIPS ISIMLHELIK LLHHARCCDV TIIRIGTSGG
160 170 180 190 200
IGIAPGTVVI TDIAVDSFFK PRFEQVILDN IVTRSTELDK ELSEELFNCS
210 220 230 240 250
KEIPNFPTLV GHTMCTYDFY EGQGRLDGAL CSFSREKKLD YLKRAFKAGV
260 270 280 290 300
RNIEMESTVF AAMCGLCGLK AAVVCVTLLD RLDCDQINLP HDVLVEYQQR
310
PQLLISNFIR RRLGLCD
Length:317
Mass (Da):35,527
Last modified:May 1, 1999 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i69F6BA1DC44977A3
GO
Isoform 2 (identifier: O95045-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLAPGCELDPDQEVVRTRPEDVPASPSTSTMIVSVLRPPSHASCTACGTVTFHIVERM

Note: No experimental confirmation available.
Show »
Length:374
Mass (Da):41,602
Checksum:iF1FF70496CD41D8F
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH33529 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti153I → M in AAO61681 (PubMed:12849978).Curated1
Sequence conflicti157T → R in AAO61681 (PubMed:12849978).Curated1
Sequence conflicti256 – 262ESTVFAA → GIYSVCS in AAO61681 (PubMed:12849978).Curated7

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02443110R → S. Corresponds to variant dbSNP:rs6710480Ensembl.1
Natural variantiVAR_03458078M → L. Corresponds to variant dbSNP:rs7561584Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0437561M → MLAPGCELDPDQEVVRTRPE DVPASPSTSTMIVSVLRPPS HASCTACGTVTFHIVERM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY225131 mRNA Translation: AAO61681.1
AK122743 mRNA Translation: BAG53699.1
AC005539 Genomic DNA Translation: AAD12227.1
BC033529 mRNA Translation: AAH33529.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2207.1 [O95045-1]
CCDS46435.1 [O95045-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001128570.1, NM_001135098.1 [O95045-2]
NP_775491.1, NM_173355.3 [O95045-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.128427

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000005756; ENSP00000005756; ENSG00000007001 [O95045-1]
ENST00000605860; ENSP00000474090; ENSG00000007001 [O95045-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
151531

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:151531

UCSC genome browser

More...
UCSCi
uc002tzp.4 human [O95045-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY225131 mRNA Translation: AAO61681.1
AK122743 mRNA Translation: BAG53699.1
AC005539 Genomic DNA Translation: AAD12227.1
BC033529 mRNA Translation: AAH33529.1 Different initiation.
CCDSiCCDS2207.1 [O95045-1]
CCDS46435.1 [O95045-2]
RefSeqiNP_001128570.1, NM_001135098.1 [O95045-2]
NP_775491.1, NM_173355.3 [O95045-1]
UniGeneiHs.128427

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XRFX-ray2.30A/B/C23-317[»]
3P0EX-ray2.00A/B/C/D/E/F21-314[»]
3P0FX-ray1.54A21-314[»]
ProteinModelPortaliO95045
SMRiO95045
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127387, 5 interactors
IntActiO95045, 5 interactors
STRINGi9606.ENSP00000387230

Chemistry databases

DrugBankiDB00544 Fluorouracil
DB05041 RP101

PTM databases

iPTMnetiO95045
PhosphoSitePlusiO95045

Polymorphism and mutation databases

BioMutaiUPP2

Proteomic databases

PaxDbiO95045
PeptideAtlasiO95045
PRIDEiO95045
ProteomicsDBi50627
50628 [O95045-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
151531
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000005756; ENSP00000005756; ENSG00000007001 [O95045-1]
ENST00000605860; ENSP00000474090; ENSG00000007001 [O95045-2]
GeneIDi151531
KEGGihsa:151531
UCSCiuc002tzp.4 human [O95045-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
151531
DisGeNETi151531
EuPathDBiHostDB:ENSG00000007001.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UPP2
HGNCiHGNC:23061 UPP2
HPAiHPA035225
HPA035226
MIMi617340 gene
neXtProtiNX_O95045
OpenTargetsiENSG00000007001
PharmGKBiPA134866434

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3728 Eukaryota
COG2820 LUCA
GeneTreeiENSGT00940000161094
HOGENOMiHOG000231747
HOVERGENiHBG047725
InParanoidiO95045
KOiK00757
OMAiFSYRYSM
OrthoDBi1423938at2759
PhylomeDBiO95045
TreeFamiTF314310

Enzyme and pathway databases

UniPathwayi
UPA00574;UER00633

BRENDAi2.4.2.3 2681
ReactomeiR-HSA-73614 Pyrimidine salvage
R-HSA-73621 Pyrimidine catabolism
SABIO-RKiO95045
SignaLinkiO95045

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UPP2 human
EvolutionaryTraceiO95045

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
151531

Protein Ontology

More...
PROi
PR:O95045

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000007001 Expressed in 57 organ(s), highest expression level in kidney epithelium
ExpressionAtlasiO95045 baseline and differential
GenevisibleiO95045 HS

Family and domain databases

InterProiView protein in InterPro
IPR018016 Nucleoside_phosphorylase_CS
IPR000845 Nucleoside_phosphorylase_d
IPR035994 Nucleoside_phosphorylase_sf
IPR010059 Uridine_phosphorylase_euk
PfamiView protein in Pfam
PF01048 PNP_UDP_1, 1 hit
SUPFAMiSSF53167 SSF53167, 1 hit
TIGRFAMsiTIGR01719 euk_UDPppase, 1 hit
PROSITEiView protein in PROSITE
PS01232 PNP_UDP_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUPP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O95045
Secondary accession number(s): B3KV87
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: May 1, 1999
Last modified: February 13, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  7. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again