Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding LIM protein 3

Gene

ABLIM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin filament binding Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418885 DCC mediated attractive signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-binding LIM protein 3
Short name:
abLIM-3
Alternative name(s):
Actin-binding LIM protein family member 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABLIM3
Synonyms:KIAA0843
ORF Names:HMFN1661
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000173210.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29132 ABLIM3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611305 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O94929

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22885

Open Targets

More...
OpenTargetsi
ENSG00000173210

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134962761

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ABLIM3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000757021 – 683Actin-binding LIM protein 3Add BLAST683

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei277PhosphoserineBy similarity1
Modified residuei280PhosphoserineBy similarity1
Modified residuei282PhosphoserineCombined sources1
Modified residuei286PhosphoserineCombined sources1
Modified residuei290PhosphoserineBy similarity1
Modified residuei337PhosphoserineBy similarity1
Modified residuei372PhosphoserineCombined sources1
Modified residuei373PhosphoserineCombined sources1
Modified residuei376PhosphotyrosineCombined sources1
Modified residuei379PhosphoserineBy similarity1
Modified residuei388PhosphoserineCombined sources1
Modified residuei493PhosphoserineCombined sources1
Modified residuei503PhosphoserineCombined sources1
Modified residuei504PhosphoserineCombined sources1
Modified residuei543PhosphothreonineCombined sources1
Modified residuei567PhosphoserineBy similarity1
Modified residuei576PhosphoserineCombined sources1
Modified residuei607PhosphoserineBy similarity1
Modified residuei631Omega-N-methylarginineBy similarity1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O94929

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O94929

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O94929

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O94929

PeptideAtlas

More...
PeptideAtlasi
O94929

PRoteomics IDEntifications database

More...
PRIDEi
O94929

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50565
50566 [O94929-2]
50567 [O94929-3]
50568 [O94929-4]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
O94929

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O94929

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O94929

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in heart and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173210 Expressed in 217 organ(s), highest expression level in lower esophagus mucosa

CleanEx database of gene expression profiles

More...
CleanExi
HS_ABLIM3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O94929 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O94929 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003245

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Directly interacts with F-actin and ABRA.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116552, 19 interactors

Protein interaction database and analysis system

More...
IntActi
O94929, 24 interactors

Molecular INTeraction database

More...
MINTi
O94929

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000310309

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1683
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UJSNMR-A609-683[»]
2DJ7NMR-A141-207[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O94929

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O94929

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O94929

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 80LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini80 – 140LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini149 – 208LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini208 – 268LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini615 – 683HPPROSITE-ProRule annotationAdd BLAST69

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1044 Eukaryota
ENOG410XRPY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153756

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000285997

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG031499

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O94929

KEGG Orthology (KO)

More...
KOi
K07520

Identification of Orthologs from Complete Genome Data

More...
OMAi
TLERYSY

Database of Orthologous Groups

More...
OrthoDBi
192350at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O94929

TreeFam database of animal gene trees

More...
TreeFami
TF318042

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.950.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028449 ABLIM3
IPR032402 AbLIM_anchor
IPR003128 Villin_headpiece
IPR036886 Villin_headpiece_dom_sf
IPR001781 Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR24213:SF0 PTHR24213:SF0, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16182 AbLIM_anchor, 1 hit
PF00412 LIM, 4 hits
PF02209 VHP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 4 hits
SM00153 VHP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47050 SSF47050, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51089 HP, 1 hit
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94929-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTSIPYQQN PYNPRGSSNV IQCYRCGDTC KGEVVRVHNN HFHIRCFTCQ
60 70 80 90 100
VCGCGLAQSG FFFKNQEYIC TQDYQQLYGT RCDSCRDFIT GEVISALGRT
110 120 130 140 150
YHPKCFVCSL CRKPFPIGDK VTFSGKECVC QTCSQSMASS KPIKIRGPSH
160 170 180 190 200
CAGCKEEIKH GQSLLALDKQ WHVSCFKCQT CSVILTGEYI SKDGVPYCES
210 220 230 240 250
DYHAQFGIKC ETCDRYISGR VLEAGGKHYH PTCARCVRCH QMFTEGEEMY
260 270 280 290 300
LTGSEVWHPI CKQAARAEKK LKHRRTSETS ISPPGSSIGS PNRVICAKVD
310 320 330 340 350
NEILNYKDLA ALPKVKSIYE VQRPDLISYE PHSRYMSDEM LERCGYGESL
360 370 380 390 400
GTLSPYSQDI YENLDLRQRR ASSPGYIDSP TYSRQGMSPT FSRSPHHYYR
410 420 430 440 450
SGPESGRSSP YHSQLDVRSS TPTSYQAPKH FHIPAGDSNI YRKPPIYKRH
460 470 480 490 500
GDLSTATKSK TSEDISQTSK YSPIYSPDPY YASESEYWTY HGSPKVPRAR
510 520 530 540 550
RFSSGGEEDD FDRSMHKLQS GIGRLILKEE MKARSSSYAD PWTPPRSSTS
560 570 580 590 600
SREALHTAGY EMSLNGSPRS HYLADSDPLI SKSASLPAYR RNGLHRTPSA
610 620 630 640 650
DLFHYDSMNA VNWGMREYKI YPYELLLVTT RGRNRLPKDV DRTRLERHLS
660 670 680
QEEFYQVFGM TISEFDRLAL WKRNELKKQA RLF
Length:683
Mass (Da):77,802
Last modified:December 7, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0392DBD9065EE08A
GO
Isoform 2 (identifier: O94929-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-358: Missing.
     402-450: Missing.
     647-683: RHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF → GNFWKSGCL

Note: No experimental confirmation available.
Show »
Length:544
Mass (Da):61,570
Checksum:iE6A19F001BF02176
GO
Isoform 3 (identifier: O94929-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     297-358: Missing.
     402-434: Missing.

Note: No experimental confirmation available.
Show »
Length:588
Mass (Da):67,073
Checksum:i858F0D8EA50B1A57
GO
Isoform 4 (identifier: O94929-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-514: Missing.

Note: No experimental confirmation available.
Show »
Length:169
Mass (Da):19,695
Checksum:i18F1F045422E1552
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGA7A0A0C4DGA7_HUMAN
Actin-binding LIM protein 3
ABLIM3
650Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHE7D6RHE7_HUMAN
Actin-binding LIM protein 3
ABLIM3
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRD5A0A0A0MRD5_HUMAN
Actin-binding LIM protein 3
ABLIM3
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA74866 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti227K → R in BAF82425 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050143125G → D. Corresponds to variant dbSNP:rs35907283Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0121261 – 514Missing in isoform 4. 1 PublicationAdd BLAST514
Alternative sequenceiVSP_012127297 – 358Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_012128402 – 450Missing in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_012129402 – 434Missing in isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_012130647 – 683RHLSQ…QARLF → GNFWKSGCL in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ413174 mRNA Translation: ABD83327.1
AB020650 mRNA Translation: BAA74866.2 Different initiation.
AK289736 mRNA Translation: BAF82425.1
AB075881 mRNA Translation: BAD38663.1
BC001665 mRNA Translation: AAH01665.1
AL833021 mRNA Translation: CAH56270.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4294.1 [O94929-1]
CCDS78071.1 [O94929-2]
CCDS87335.1 [O94929-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001287944.1, NM_001301015.2 [O94929-1]
NP_001287947.1, NM_001301018.2
NP_001287956.1, NM_001301027.2
NP_001287957.1, NM_001301028.2 [O94929-2]
NP_001332787.1, NM_001345858.1
NP_001332788.1, NM_001345859.1 [O94929-3]
NP_001332789.1, NM_001345860.1
NP_001332790.1, NM_001345861.1 [O94929-3]
NP_055760.1, NM_014945.4 [O94929-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.49688

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309868; ENSP00000310309; ENSG00000173210 [O94929-1]
ENST00000326685; ENSP00000315841; ENSG00000173210 [O94929-3]
ENST00000504238; ENSP00000421183; ENSG00000173210 [O94929-2]
ENST00000506113; ENSP00000425394; ENSG00000173210 [O94929-1]
ENST00000517451; ENSP00000430150; ENSG00000173210 [O94929-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22885

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22885

UCSC genome browser

More...
UCSCi
uc003lpy.3 human [O94929-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413174 mRNA Translation: ABD83327.1
AB020650 mRNA Translation: BAA74866.2 Different initiation.
AK289736 mRNA Translation: BAF82425.1
AB075881 mRNA Translation: BAD38663.1
BC001665 mRNA Translation: AAH01665.1
AL833021 mRNA Translation: CAH56270.1
CCDSiCCDS4294.1 [O94929-1]
CCDS78071.1 [O94929-2]
CCDS87335.1 [O94929-3]
RefSeqiNP_001287944.1, NM_001301015.2 [O94929-1]
NP_001287947.1, NM_001301018.2
NP_001287956.1, NM_001301027.2
NP_001287957.1, NM_001301028.2 [O94929-2]
NP_001332787.1, NM_001345858.1
NP_001332788.1, NM_001345859.1 [O94929-3]
NP_001332789.1, NM_001345860.1
NP_001332790.1, NM_001345861.1 [O94929-3]
NP_055760.1, NM_014945.4 [O94929-1]
UniGeneiHs.49688

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UJSNMR-A609-683[»]
2DJ7NMR-A141-207[»]
ProteinModelPortaliO94929
SMRiO94929
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116552, 19 interactors
IntActiO94929, 24 interactors
MINTiO94929
STRINGi9606.ENSP00000310309

PTM databases

CarbonylDBiO94929
iPTMnetiO94929
PhosphoSitePlusiO94929

Polymorphism and mutation databases

BioMutaiABLIM3

Proteomic databases

EPDiO94929
jPOSTiO94929
MaxQBiO94929
PaxDbiO94929
PeptideAtlasiO94929
PRIDEiO94929
ProteomicsDBi50565
50566 [O94929-2]
50567 [O94929-3]
50568 [O94929-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22885
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309868; ENSP00000310309; ENSG00000173210 [O94929-1]
ENST00000326685; ENSP00000315841; ENSG00000173210 [O94929-3]
ENST00000504238; ENSP00000421183; ENSG00000173210 [O94929-2]
ENST00000506113; ENSP00000425394; ENSG00000173210 [O94929-1]
ENST00000517451; ENSP00000430150; ENSG00000173210 [O94929-4]
GeneIDi22885
KEGGihsa:22885
UCSCiuc003lpy.3 human [O94929-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22885
DisGeNETi22885
EuPathDBiHostDB:ENSG00000173210.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABLIM3
HGNCiHGNC:29132 ABLIM3
HPAiHPA003245
MIMi611305 gene
neXtProtiNX_O94929
OpenTargetsiENSG00000173210
PharmGKBiPA134962761

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1044 Eukaryota
ENOG410XRPY LUCA
GeneTreeiENSGT00940000153756
HOGENOMiHOG000285997
HOVERGENiHBG031499
InParanoidiO94929
KOiK07520
OMAiTLERYSY
OrthoDBi192350at2759
PhylomeDBiO94929
TreeFamiTF318042

Enzyme and pathway databases

ReactomeiR-HSA-418885 DCC mediated attractive signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABLIM3 human
EvolutionaryTraceiO94929

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ABLIM3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22885

Protein Ontology

More...
PROi
PR:O94929

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173210 Expressed in 217 organ(s), highest expression level in lower esophagus mucosa
CleanExiHS_ABLIM3
ExpressionAtlasiO94929 baseline and differential
GenevisibleiO94929 HS

Family and domain databases

Gene3Di1.10.950.10, 1 hit
InterProiView protein in InterPro
IPR028449 ABLIM3
IPR032402 AbLIM_anchor
IPR003128 Villin_headpiece
IPR036886 Villin_headpiece_dom_sf
IPR001781 Znf_LIM
PANTHERiPTHR24213:SF0 PTHR24213:SF0, 1 hit
PfamiView protein in Pfam
PF16182 AbLIM_anchor, 1 hit
PF00412 LIM, 4 hits
PF02209 VHP, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 4 hits
SM00153 VHP, 1 hit
SUPFAMiSSF47050 SSF47050, 1 hit
PROSITEiView protein in PROSITE
PS51089 HP, 1 hit
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABLM3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94929
Secondary accession number(s): A8K121
, Q19VH3, Q658S1, Q68CI5, Q9BV32
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: January 16, 2019
This is version 163 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again