Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (13 Feb 2019)
Sequence version 3 (18 Apr 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cyclin-dependent kinase 14

Gene

CDK14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Serine/threonine-protein kinase activity is promoted by associated cyclins CCDN3 and CCNY and repressed by CDKN1A.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei164ATPCurated1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei256Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi141 – 149ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • cyclin binding Source: UniProtKB
  • cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • G2/M transition of mitotic cell cycle Source: UniProtKB
  • protein phosphorylation Source: GO_Central
  • regulation of canonical Wnt signaling pathway Source: UniProtKB
  • Wnt signaling pathway Source: UniProtKB-KW

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCell cycle, Cell division, Wnt signaling pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O94921

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O94921

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-dependent kinase 14 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 14
Serine/threonine-protein kinase PFTAIRE-1
Short name:
hPFTAIRE1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDK14
Synonyms:KIAA0834, PFTK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000058091.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8883 CDK14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610679 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O94921

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi164K → R: Abolishes protein kinase activity. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
5218

Open Targets

More...
OpenTargetsi
ENSG00000058091

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33221

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6162

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDK14

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000865061 – 469Cyclin-dependent kinase 14Add BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineCombined sources1
Modified residuei78PhosphoserineCombined sources1
Modified residuei95PhosphoserineCombined sources1
Modified residuei134PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O94921

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O94921

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O94921

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O94921

PeptideAtlas

More...
PeptideAtlasi
O94921

PRoteomics IDEntifications database

More...
PRIDEi
O94921

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50556
50557 [O94921-2]
50558 [O94921-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O94921

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O94921

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000058091 Expressed in 225 organ(s), highest expression level in postcentral gyrus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O94921 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O94921 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015267

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with LRP6, CCNY and CAPRIN2 during G2/M stage; CAPRIN2 functions as a scaffold for the complex by binding to CCNY via its N terminus and to CDK14 via its C terminus (PubMed:27821587). Interacts with CCNY; CCNY mediates its recruitment to the plasma membrane and promotes phosphorylation of LRP6 (PubMed:20059949, PubMed:19524571). Interacts with CCDN3 and CDKN1A (PubMed:17517622). Interacts with SEPT8 (PubMed:12098780). Interacts with 14-3-3 proteina YWHAB, YWHAE, YWHAH and YWHAQ (PubMed:16775625).6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111239, 22 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-364 Cyclin Y-CDK14 complex

Database of interacting proteins

More...
DIPi
DIP-39618N

Protein interaction database and analysis system

More...
IntActi
O94921, 13 interactors

Molecular INTeraction database

More...
MINTi
O94921

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265741

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O94921

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O94921

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O94921

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini135 – 419Protein kinasePROSITE-ProRule annotationAdd BLAST285

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0594 Eukaryota
ENOG410XPP3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157640

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG014652

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O94921

KEGG Orthology (KO)

More...
KOi
K08821

Identification of Orthologs from Complete Genome Data

More...
OMAi
PERFTQY

Database of Orthologous Groups

More...
OrthoDBi
1010560at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O94921

TreeFam database of animal gene trees

More...
TreeFami
TF106508

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94921-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCDLIEPQPA EKIGKMKKLR RTLSESFSRI ALKKDDTTFD EICVTKMSTR
60 70 80 90 100
NCQGMDSVIK PLDTIPEDKK VRVQRTQSTF DPFEKPANQV KRVHSENNAC
110 120 130 140 150
INFKTSSTGK ESPKVRRHSS PSSPTSPKFG KADSYEKLEK LGEGSYATVY
160 170 180 190 200
KGKSKVNGKL VALKVIRLQE EEGTPFTAIR EASLLKGLKH ANIVLLHDII
210 220 230 240 250
HTKETLTLVF EYVHTDLCQY MDKHPGGLHP DNVKLFLFQL LRGLSYIHQR
260 270 280 290 300
YILHRDLKPQ NLLISDTGEL KLADFGLARA KSVPSHTYSN EVVTLWYRPP
310 320 330 340 350
DVLLGSTEYS TCLDMWGVGC IFVEMIQGVA AFPGMKDIQD QLERIFLVLG
360 370 380 390 400
TPNEDTWPGV HSLPHFKPER FTLYSSKNLR QAWNKLSYVN HAEDLASKLL
410 420 430 440 450
QCSPKNRLSA QAALSHEYFS DLPPRLWELT DMSSIFTVPN VRLQPEAGES
460
MRAFGKNNSY GKSLSNSKH
Length:469
Mass (Da):53,057
Last modified:April 18, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i32CF9B9B7BD9CE0E
GO
Isoform 2 (identifier: O94921-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDE → MHGYFGCNAAAEPGYSAFVGTPQ

Show »
Length:451
Mass (Da):50,662
Checksum:i68210FCBC0D44031
GO
Isoform 3 (identifier: O94921-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):47,760
Checksum:i5F5D5B2C611243FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IYJ9C9IYJ9_HUMAN
Cyclin-dependent kinase 14
CDK14
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EUK8E7EUK8_HUMAN
Cyclin-dependent kinase 14
CDK14
340Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWL6C9JWL6_HUMAN
Cyclin-dependent kinase 14
CDK14
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WF96F8WF96_HUMAN
Cyclin-dependent kinase 14
CDK14
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA74857 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8Q → R in BAG60284 (PubMed:14702039).Curated1
Sequence conflicti158G → W in AAG43234 (PubMed:11313143).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_046765432M → I in an ovarian mucinous carcinoma; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs773301216Ensembl.1
Natural variantiVAR_046766463S → R1 PublicationCorresponds to variant dbSNP:rs35643773Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387621 – 46Missing in isoform 3. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0048031 – 41MCDLI…TTFDE → MHGYFGCNAAAEPGYSAFVG TPQ in isoform 2. 2 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF119833 mRNA Translation: AAG43234.1
AB020641 mRNA Translation: BAA74857.2 Different initiation.
AK289782 mRNA Translation: BAF82471.1
AK295086 mRNA Translation: BAG58127.1
AK297974 mRNA Translation: BAG60284.1
AK316026 mRNA Translation: BAH14397.1
AC000057 Genomic DNA Translation: AAS07411.1
AC000059 Genomic DNA No translation available.
AC002065 Genomic DNA Translation: AAM48566.1
AC002456 Genomic DNA No translation available.
AC002458 Genomic DNA Translation: AAS07412.1
AC006036 Genomic DNA Translation: AAF19245.1
CH236949 Genomic DNA Translation: EAL24162.1
CH471091 Genomic DNA Translation: EAW76873.1
CH471091 Genomic DNA Translation: EAW76874.1
BC136476 mRNA Translation: AAI36477.1
BC136477 mRNA Translation: AAI36478.1
BC152388 mRNA Translation: AAI52389.1
BC152436 mRNA Translation: AAI52437.1
BC167152 mRNA Translation: AAI67152.1
BC167156 mRNA Translation: AAI67156.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5619.1 [O94921-2]
CCDS75626.1 [O94921-1]
CCDS75627.1 [O94921-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001274064.1, NM_001287135.1 [O94921-1]
NP_001274065.1, NM_001287136.1 [O94921-3]
NP_001274066.1, NM_001287137.1
NP_036527.1, NM_012395.3 [O94921-2]
XP_005250495.1, XM_005250438.3 [O94921-3]
XP_005250496.1, XM_005250439.2 [O94921-3]
XP_011514608.1, XM_011516306.2 [O94921-1]
XP_016867809.1, XM_017012320.1 [O94921-3]
XP_016867810.1, XM_017012321.1 [O94921-3]
XP_016867811.1, XM_017012322.1 [O94921-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.258576
Hs.430742
Hs.740065

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265741; ENSP00000265741; ENSG00000058091 [O94921-2]
ENST00000380050; ENSP00000369390; ENSG00000058091 [O94921-1]
ENST00000406263; ENSP00000385034; ENSG00000058091 [O94921-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5218

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5218

UCSC genome browser

More...
UCSCi
uc003uky.4 human [O94921-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF119833 mRNA Translation: AAG43234.1
AB020641 mRNA Translation: BAA74857.2 Different initiation.
AK289782 mRNA Translation: BAF82471.1
AK295086 mRNA Translation: BAG58127.1
AK297974 mRNA Translation: BAG60284.1
AK316026 mRNA Translation: BAH14397.1
AC000057 Genomic DNA Translation: AAS07411.1
AC000059 Genomic DNA No translation available.
AC002065 Genomic DNA Translation: AAM48566.1
AC002456 Genomic DNA No translation available.
AC002458 Genomic DNA Translation: AAS07412.1
AC006036 Genomic DNA Translation: AAF19245.1
CH236949 Genomic DNA Translation: EAL24162.1
CH471091 Genomic DNA Translation: EAW76873.1
CH471091 Genomic DNA Translation: EAW76874.1
BC136476 mRNA Translation: AAI36477.1
BC136477 mRNA Translation: AAI36478.1
BC152388 mRNA Translation: AAI52389.1
BC152436 mRNA Translation: AAI52437.1
BC167152 mRNA Translation: AAI67152.1
BC167156 mRNA Translation: AAI67156.1
CCDSiCCDS5619.1 [O94921-2]
CCDS75626.1 [O94921-1]
CCDS75627.1 [O94921-3]
RefSeqiNP_001274064.1, NM_001287135.1 [O94921-1]
NP_001274065.1, NM_001287136.1 [O94921-3]
NP_001274066.1, NM_001287137.1
NP_036527.1, NM_012395.3 [O94921-2]
XP_005250495.1, XM_005250438.3 [O94921-3]
XP_005250496.1, XM_005250439.2 [O94921-3]
XP_011514608.1, XM_011516306.2 [O94921-1]
XP_016867809.1, XM_017012320.1 [O94921-3]
XP_016867810.1, XM_017012321.1 [O94921-3]
XP_016867811.1, XM_017012322.1 [O94921-3]
UniGeneiHs.258576
Hs.430742
Hs.740065

3D structure databases

ProteinModelPortaliO94921
SMRiO94921
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111239, 22 interactors
ComplexPortaliCPX-364 Cyclin Y-CDK14 complex
DIPiDIP-39618N
IntActiO94921, 13 interactors
MINTiO94921
STRINGi9606.ENSP00000265741

Chemistry databases

BindingDBiO94921
ChEMBLiCHEMBL6162

PTM databases

iPTMnetiO94921
PhosphoSitePlusiO94921

Polymorphism and mutation databases

BioMutaiCDK14

Proteomic databases

EPDiO94921
jPOSTiO94921
MaxQBiO94921
PaxDbiO94921
PeptideAtlasiO94921
PRIDEiO94921
ProteomicsDBi50556
50557 [O94921-2]
50558 [O94921-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5218
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265741; ENSP00000265741; ENSG00000058091 [O94921-2]
ENST00000380050; ENSP00000369390; ENSG00000058091 [O94921-1]
ENST00000406263; ENSP00000385034; ENSG00000058091 [O94921-3]
GeneIDi5218
KEGGihsa:5218
UCSCiuc003uky.4 human [O94921-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5218
DisGeNETi5218
EuPathDBiHostDB:ENSG00000058091.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDK14
HGNCiHGNC:8883 CDK14
HPAiHPA015267
MIMi610679 gene
neXtProtiNX_O94921
OpenTargetsiENSG00000058091
PharmGKBiPA33221

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0594 Eukaryota
ENOG410XPP3 LUCA
GeneTreeiENSGT00940000157640
HOVERGENiHBG014652
InParanoidiO94921
KOiK08821
OMAiPERFTQY
OrthoDBi1010560at2759
PhylomeDBiO94921
TreeFamiTF106508

Enzyme and pathway databases

SignaLinkiO94921
SIGNORiO94921

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDK14 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PFTK1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5218

Protein Ontology

More...
PROi
PR:O94921

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000058091 Expressed in 225 organ(s), highest expression level in postcentral gyrus
ExpressionAtlasiO94921 baseline and differential
GenevisibleiO94921 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDK14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94921
Secondary accession number(s): A4D1E6
, A6NK51, A8WFP6, B4DHG5, B4DNM2, Q75N06, Q75N22, Q8N764, Q9H3D7, Q9UDR0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: April 18, 2006
Last modified: February 13, 2019
This is version 178 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again