Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (13 Feb 2019)
Sequence version 2 (24 Nov 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

PHD finger protein 14

Gene

PHF14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PHD finger protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PHF14
Synonyms:KIAA0783
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000106443.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:22203 PHF14

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O94880

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000106443

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134867397

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PHF14

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000593061 – 888PHD finger protein 14Add BLAST888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineCombined sources1
Modified residuei29PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei91PhosphoserineCombined sources1
Modified residuei196PhosphoserineCombined sources1
Modified residuei206PhosphotyrosineCombined sources1
Modified residuei208PhosphoserineCombined sources1
Modified residuei287PhosphothreonineCombined sources1
Modified residuei290PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei308PhosphoserineCombined sources1
Modified residuei359PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei782PhosphoserineBy similarity1
Modified residuei835PhosphoserineCombined sources1
Isoform 2 (identifier: O94880-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki648Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sourcesCurated
Modified residuei651PhosphoserineCombined sourcesCurated1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O94880

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O94880

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O94880

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O94880

PeptideAtlas

More...
PeptideAtlasi
O94880

PRoteomics IDEntifications database

More...
PRIDEi
O94880

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50520
50521 [O94880-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O94880

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O94880

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106443 Expressed in 202 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O94880 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O94880 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000538
HPA017376

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
KIF4AO952394EBI-2680164,EBI-1057516

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115032, 28 interactors

Protein interaction database and analysis system

More...
IntActi
O94880, 23 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000385795

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O94880

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O94880

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi62 – 137Glu/Lys-richAdd BLAST76

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0957 Eukaryota
COG5141 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156923

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015231

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053584

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O94880

Database of Orthologous Groups

More...
OrthoDBi
566217at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O94880

TreeFam database of animal gene trees

More...
TreeFami
TF316118

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034732 EPHD
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00628 PHD, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00249 PHD, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903 SSF57903, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51805 EPHD, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94880-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSSKRRQV KPLAASLLEA LDYDSSDDSD FKVGDASDSE GSGNGSEDAS
60 70 80 90 100
KDSGEGSCSD SEENILEEEL NEDIKVKEEQ LKNSAEEEVL SSEKQLIKME
110 120 130 140 150
KKEEEENGER PRKKKEKEKE KEKEKEKEKE REKEKEKATV SENVAASAAA
160 170 180 190 200
TTPATSPPAV NTSPSVPTTT TATEEQVSEP KKWNLRRNRP LLDFVSMEEL
210 220 230 240 250
NDMDDYDSED DNDWRPTVVK RKGRSASQKE GSDGDNEDDE DEGSGSDEDE
260 270 280 290 300
NDEGNDEDHS SPASEGGCKK KKSKVLSRNS ADDEELTNDS LTLSQSKSNE
310 320 330 340 350
DSLILEKSQN WSSQKMDHIL ICCVCLGDNS EDADEIIQCD NCGITVHEGC
360 370 380 390 400
YGVDGESDSI MSSASENSTE PWFCDACKCG VSPSCELCPN QDGIFKETDA
410 420 430 440 450
GRWVHIVCAL YVPGVAFGDI DKLRPVTLTE MNYSKYGAKE CSFCEDPRFA
460 470 480 490 500
RTGVCISCDA GMCRAYFHVT CAQKEGLLSE AAAEEDIADP FFAYCKQHAD
510 520 530 540 550
RLDRKWKRKN YLALQSYCKM SLQEREKQLS PEAQARINAR LQQYRAKAEL
560 570 580 590 600
ARSTRPQAWV PREKLPRPLT SSASAIRKLM RKAELMGIST DIFPVDNSDT
610 620 630 640 650
SSSVDGRRKH KQPALTADFV NYYFERNMRM IQIQENMAEQ KNIKDKLENE
660 670 680 690 700
QEKLHVEYNK LCESLEELQN LNGKLRSEGQ GIWALLGRIT GQKLNIPAIL
710 720 730 740 750
RAPKERKPSK KEGGTQKTST LPAVLYSCGI CKKNHDQHLL LLCDTCKLHY
760 770 780 790 800
HLGCLDPPLT RMPRKTKNSY WQCSECDQAG SSDMEADMAM ETLPDGTKRS
810 820 830 840 850
RRQIKEPVKF VPQDVPPEPK KIPIRNTRTR GRKRSFVPEE EKHEERVPRE
860 870 880
RRQRQSVLQK KPKAEDLRTE CATCKGTGDN ENLVRYPS
Length:888
Mass (Da):100,053
Last modified:November 24, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC356A84BE525932
GO
Isoform 2 (identifier: O94880-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-285: Missing.
     286-300: LTNDSLTLSQSKSNE → MIVQMTVILKLEMPQ
     886-888: YPS → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAERKNISQELNMEQKNPKK

Note: Dubious isoform. Alternative initiation from a downstream AUG is supported by ribosome profiling data.Combined sourcesCurated
Show »
Length:663
Mass (Da):75,504
Checksum:i5B081B62F5792D16
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DG57B4DG57_HUMAN
cDNA FLJ61230, highly similar to PH...
PHF14
603Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRH6A0A0U1RRH6_HUMAN
PHD finger protein 14
PHF14
948Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHD5E5RHD5_HUMAN
PHD finger protein 14
PHF14
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34503 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti395F → S in BAG58394 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018480115K → R1 PublicationCorresponds to variant dbSNP:rs218966Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0359991 – 285Missing in isoform 2. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_036000286 – 300LTNDS…SKSNE → MIVQMTVILKLEMPQ in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_036001886 – 888YPS → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAERKNISQELNMEQKN PKK in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB018326 mRNA Translation: BAA34503.2 Different initiation.
AK295461 mRNA Translation: BAG58394.1
AC005007 Genomic DNA No translation available.
AC007029 Genomic DNA No translation available.
AC080064 Genomic DNA No translation available.
AC104089 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93634.1
BC152414 mRNA Translation: AAI52415.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47542.1 [O94880-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055475.2, NM_014660.3 [O94880-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655688

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000403050; ENSP00000385795; ENSG00000106443 [O94880-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9678

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9678

UCSC genome browser

More...
UCSCi
uc003sry.3 human [O94880-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018326 mRNA Translation: BAA34503.2 Different initiation.
AK295461 mRNA Translation: BAG58394.1
AC005007 Genomic DNA No translation available.
AC007029 Genomic DNA No translation available.
AC080064 Genomic DNA No translation available.
AC104089 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93634.1
BC152414 mRNA Translation: AAI52415.1
CCDSiCCDS47542.1 [O94880-1]
RefSeqiNP_055475.2, NM_014660.3 [O94880-1]
UniGeneiHs.655688

3D structure databases

ProteinModelPortaliO94880
SMRiO94880
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115032, 28 interactors
IntActiO94880, 23 interactors
STRINGi9606.ENSP00000385795

PTM databases

iPTMnetiO94880
PhosphoSitePlusiO94880

Polymorphism and mutation databases

BioMutaiPHF14

Proteomic databases

EPDiO94880
jPOSTiO94880
MaxQBiO94880
PaxDbiO94880
PeptideAtlasiO94880
PRIDEiO94880
ProteomicsDBi50520
50521 [O94880-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000403050; ENSP00000385795; ENSG00000106443 [O94880-1]
GeneIDi9678
KEGGihsa:9678
UCSCiuc003sry.3 human [O94880-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9678
EuPathDBiHostDB:ENSG00000106443.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PHF14

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0006485
HGNCiHGNC:22203 PHF14
HPAiHPA000538
HPA017376
neXtProtiNX_O94880
OpenTargetsiENSG00000106443
PharmGKBiPA134867397

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0957 Eukaryota
COG5141 LUCA
GeneTreeiENSGT00940000156923
HOGENOMiHOG000015231
HOVERGENiHBG053584
InParanoidiO94880
OrthoDBi566217at2759
PhylomeDBiO94880
TreeFamiTF316118

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PHF14 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9678

Protein Ontology

More...
PROi
PR:O94880

Gene expression databases

BgeeiENSG00000106443 Expressed in 202 organ(s), highest expression level in intestine
ExpressionAtlasiO94880 baseline and differential
GenevisibleiO94880 HS

Family and domain databases

Gene3Di3.30.40.10, 3 hits
InterProiView protein in InterPro
IPR034732 EPHD
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628 PHD, 2 hits
SMARTiView protein in SMART
SM00249 PHD, 3 hits
SUPFAMiSSF57903 SSF57903, 2 hits
PROSITEiView protein in PROSITE
PS51805 EPHD, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHF14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94880
Secondary accession number(s): A7MCZ3, B4DI82
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 24, 2009
Last modified: February 13, 2019
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again