Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PHD finger protein 14

Gene

PHF14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 14
Gene namesi
Name:PHF14
Synonyms:KIAA0783
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000106443.15
HGNCiHGNC:22203 PHF14
neXtProtiNX_O94880

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000106443
PharmGKBiPA134867397

Polymorphism and mutation databases

BioMutaiPHF14

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000593061 – 888PHD finger protein 14Add BLAST888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei26PhosphoserineCombined sources1
Modified residuei29PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei91PhosphoserineCombined sources1
Modified residuei196PhosphoserineCombined sources1
Modified residuei206PhosphotyrosineCombined sources1
Modified residuei208PhosphoserineCombined sources1
Modified residuei287PhosphothreonineCombined sources1
Modified residuei290PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei308PhosphoserineCombined sources1
Modified residuei359PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei782PhosphoserineBy similarity1
Modified residuei835PhosphoserineCombined sources1
Isoform 2 (identifier: O94880-2)
Cross-linki648Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sourcesCurated
Modified residuei651PhosphoserineCombined sourcesCurated1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO94880
MaxQBiO94880
PaxDbiO94880
PeptideAtlasiO94880
PRIDEiO94880
ProteomicsDBi50520
50521 [O94880-2]

PTM databases

iPTMnetiO94880
PhosphoSitePlusiO94880

Expressioni

Gene expression databases

BgeeiENSG00000106443 Expressed in 202 organ(s), highest expression level in intestine
CleanExiHS_PHF14
ExpressionAtlasiO94880 baseline and differential
GenevisibleiO94880 HS

Organism-specific databases

HPAiHPA000538
HPA017376

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KIF4AO952394EBI-2680164,EBI-1057516

Protein-protein interaction databases

BioGridi115032, 25 interactors
IntActiO94880, 23 interactors
STRINGi9606.ENSP00000385795

Structurei

3D structure databases

ProteinModelPortaliO94880
SMRiO94880
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi62 – 137Glu/Lys-richAdd BLAST76

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri319 – 380PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri382 – 415C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri439 – 499PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri725 – 779PHD-type 3PROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0957 Eukaryota
COG5141 LUCA
GeneTreeiENSGT00740000114866
HOGENOMiHOG000015231
HOVERGENiHBG053584
InParanoidiO94880
OrthoDBiEOG091G02FR
PhylomeDBiO94880
TreeFamiTF316118

Family and domain databases

Gene3Di3.30.40.10, 3 hits
InterProiView protein in InterPro
IPR034732 EPHD
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628 PHD, 2 hits
SMARTiView protein in SMART
SM00249 PHD, 3 hits
SUPFAMiSSF57903 SSF57903, 2 hits
PROSITEiView protein in PROSITE
PS51805 EPHD, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94880-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSSKRRQV KPLAASLLEA LDYDSSDDSD FKVGDASDSE GSGNGSEDAS
60 70 80 90 100
KDSGEGSCSD SEENILEEEL NEDIKVKEEQ LKNSAEEEVL SSEKQLIKME
110 120 130 140 150
KKEEEENGER PRKKKEKEKE KEKEKEKEKE REKEKEKATV SENVAASAAA
160 170 180 190 200
TTPATSPPAV NTSPSVPTTT TATEEQVSEP KKWNLRRNRP LLDFVSMEEL
210 220 230 240 250
NDMDDYDSED DNDWRPTVVK RKGRSASQKE GSDGDNEDDE DEGSGSDEDE
260 270 280 290 300
NDEGNDEDHS SPASEGGCKK KKSKVLSRNS ADDEELTNDS LTLSQSKSNE
310 320 330 340 350
DSLILEKSQN WSSQKMDHIL ICCVCLGDNS EDADEIIQCD NCGITVHEGC
360 370 380 390 400
YGVDGESDSI MSSASENSTE PWFCDACKCG VSPSCELCPN QDGIFKETDA
410 420 430 440 450
GRWVHIVCAL YVPGVAFGDI DKLRPVTLTE MNYSKYGAKE CSFCEDPRFA
460 470 480 490 500
RTGVCISCDA GMCRAYFHVT CAQKEGLLSE AAAEEDIADP FFAYCKQHAD
510 520 530 540 550
RLDRKWKRKN YLALQSYCKM SLQEREKQLS PEAQARINAR LQQYRAKAEL
560 570 580 590 600
ARSTRPQAWV PREKLPRPLT SSASAIRKLM RKAELMGIST DIFPVDNSDT
610 620 630 640 650
SSSVDGRRKH KQPALTADFV NYYFERNMRM IQIQENMAEQ KNIKDKLENE
660 670 680 690 700
QEKLHVEYNK LCESLEELQN LNGKLRSEGQ GIWALLGRIT GQKLNIPAIL
710 720 730 740 750
RAPKERKPSK KEGGTQKTST LPAVLYSCGI CKKNHDQHLL LLCDTCKLHY
760 770 780 790 800
HLGCLDPPLT RMPRKTKNSY WQCSECDQAG SSDMEADMAM ETLPDGTKRS
810 820 830 840 850
RRQIKEPVKF VPQDVPPEPK KIPIRNTRTR GRKRSFVPEE EKHEERVPRE
860 870 880
RRQRQSVLQK KPKAEDLRTE CATCKGTGDN ENLVRYPS
Length:888
Mass (Da):100,053
Last modified:November 24, 2009 - v2
Checksum:iDC356A84BE525932
GO
Isoform 2 (identifier: O94880-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-285: Missing.
     286-300: LTNDSLTLSQSKSNE → MIVQMTVILKLEMPQ
     886-888: YPS → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAERKNISQELNMEQKNPKK

Note: Dubious isoform. Alternative initiation from a downstream AUG is supported by ribosome profiling data.Combined sourcesCurated
Show »
Length:663
Mass (Da):75,504
Checksum:i5B081B62F5792D16
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DG57B4DG57_HUMAN
cDNA FLJ61230, highly similar to PH...
PHF14
603Annotation score:
A0A0U1RRH6A0A0U1RRH6_HUMAN
PHD finger protein 14
PHF14
948Annotation score:
E5RHD5E5RHD5_HUMAN
PHD finger protein 14
PHF14
42Annotation score:

Sequence cautioni

The sequence BAA34503 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti395F → S in BAG58394 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018480115K → R1 PublicationCorresponds to variant dbSNP:rs218966Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0359991 – 285Missing in isoform 2. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_036000286 – 300LTNDS…SKSNE → MIVQMTVILKLEMPQ in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_036001886 – 888YPS → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAERKNISQELNMEQKN PKK in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018326 mRNA Translation: BAA34503.2 Different initiation.
AK295461 mRNA Translation: BAG58394.1
AC005007 Genomic DNA No translation available.
AC007029 Genomic DNA No translation available.
AC080064 Genomic DNA No translation available.
AC104089 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93634.1
BC152414 mRNA Translation: AAI52415.1
CCDSiCCDS47542.1 [O94880-1]
RefSeqiNP_055475.2, NM_014660.3 [O94880-1]
UniGeneiHs.655688

Genome annotation databases

EnsembliENST00000403050; ENSP00000385795; ENSG00000106443 [O94880-1]
GeneIDi9678
KEGGihsa:9678
UCSCiuc003sry.3 human [O94880-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018326 mRNA Translation: BAA34503.2 Different initiation.
AK295461 mRNA Translation: BAG58394.1
AC005007 Genomic DNA No translation available.
AC007029 Genomic DNA No translation available.
AC080064 Genomic DNA No translation available.
AC104089 Genomic DNA No translation available.
CH471073 Genomic DNA Translation: EAW93634.1
BC152414 mRNA Translation: AAI52415.1
CCDSiCCDS47542.1 [O94880-1]
RefSeqiNP_055475.2, NM_014660.3 [O94880-1]
UniGeneiHs.655688

3D structure databases

ProteinModelPortaliO94880
SMRiO94880
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115032, 25 interactors
IntActiO94880, 23 interactors
STRINGi9606.ENSP00000385795

PTM databases

iPTMnetiO94880
PhosphoSitePlusiO94880

Polymorphism and mutation databases

BioMutaiPHF14

Proteomic databases

EPDiO94880
MaxQBiO94880
PaxDbiO94880
PeptideAtlasiO94880
PRIDEiO94880
ProteomicsDBi50520
50521 [O94880-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000403050; ENSP00000385795; ENSG00000106443 [O94880-1]
GeneIDi9678
KEGGihsa:9678
UCSCiuc003sry.3 human [O94880-1]

Organism-specific databases

CTDi9678
EuPathDBiHostDB:ENSG00000106443.15
GeneCardsiPHF14
H-InvDBiHIX0006485
HGNCiHGNC:22203 PHF14
HPAiHPA000538
HPA017376
neXtProtiNX_O94880
OpenTargetsiENSG00000106443
PharmGKBiPA134867397
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0957 Eukaryota
COG5141 LUCA
GeneTreeiENSGT00740000114866
HOGENOMiHOG000015231
HOVERGENiHBG053584
InParanoidiO94880
OrthoDBiEOG091G02FR
PhylomeDBiO94880
TreeFamiTF316118

Miscellaneous databases

ChiTaRSiPHF14 human
GenomeRNAii9678
PROiPR:O94880

Gene expression databases

BgeeiENSG00000106443 Expressed in 202 organ(s), highest expression level in intestine
CleanExiHS_PHF14
ExpressionAtlasiO94880 baseline and differential
GenevisibleiO94880 HS

Family and domain databases

Gene3Di3.30.40.10, 3 hits
InterProiView protein in InterPro
IPR034732 EPHD
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628 PHD, 2 hits
SMARTiView protein in SMART
SM00249 PHD, 3 hits
SUPFAMiSSF57903 SSF57903, 2 hits
PROSITEiView protein in PROSITE
PS51805 EPHD, 1 hit
PS01359 ZF_PHD_1, 2 hits
PS50016 ZF_PHD_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiPHF14_HUMAN
AccessioniPrimary (citable) accession number: O94880
Secondary accession number(s): A7MCZ3, B4DI82
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 24, 2009
Last modified: September 12, 2018
This is version 143 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again