Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorbin and SH3 domain-containing protein 2

Gene

SORBS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1. May play a role in the regulation of pancreatic cell adhesion, possibly by acting on WASF1 phosphorylation, enhancing phosphorylation by ABL1, as well as dephosphorylation by PTPN12 (PubMed:18559503). Isoform 6 increases water and sodium absorption in the intestine and gall-bladder.3 Publications

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLinkiO94875
SIGNORiO94875

Names & Taxonomyi

Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg-binding protein 2
Short name:
ArgBP2
Arg/Abl-interacting protein 2
Sorbin
Gene namesi
Name:SORBS2
Synonyms:ARGBP2, KIAA0777
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000154556.17
HGNCiHGNC:24098 SORBS2
MIMi616349 gene
neXtProtiNX_O94875

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi8470
OpenTargetsiENSG00000154556
PharmGKBiPA142670890

Polymorphism and mutation databases

BioMutaiSORBS2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003444771 – 1100Sorbin and SH3 domain-containing protein 2Add BLAST1100

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei30PhosphoserineBy similarity1
Modified residuei43PhosphoserineBy similarity1
Modified residuei154PhosphoserineCombined sources1
Modified residuei157PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1
Modified residuei245PhosphoserineBy similarity1
Modified residuei248PhosphoserineBy similarity1
Modified residuei259PhosphoserineCombined sources1
Modified residuei277PhosphothreonineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei292PhosphothreonineCombined sources1
Modified residuei297PhosphoserineBy similarity1
Modified residuei298PhosphoserineCombined sources1
Modified residuei299PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei383PhosphoserineBy similarity1
Modified residuei494PhosphoserineBy similarity1
Modified residuei497PhosphoserineBy similarity1
Modified residuei550PhosphoserineBy similarity1
Modified residuei750PhosphoserineBy similarity1
Modified residuei843PhosphoserineCombined sources1
Modified residuei1017PhosphoserineBy similarity1
Modified residuei1023PhosphoserineCombined sources1
Isoform 9 (identifier: O94875-9)
Modified residuei13PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Isoform 12 (identifier: O94875-12)
Modified residuei13PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Modified residuei320PhosphothreonineCombined sources1
Modified residuei322PhosphothreonineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Modified residuei366PhosphothreonineCombined sources1
Modified residuei381PhosphoserineCombined sources1
Isoform 11 (identifier: O94875-11)
Modified residuei27PhosphoserineCombined sources1
Modified residuei28PhosphoserineCombined sources1
Isoform 6 (identifier: O94875-6)
Modified residuei153Alanine amide1 Publication1
Isoform 3 (identifier: O94875-3)
Modified residuei234PhosphothreonineCombined sources1
Modified residuei236PhosphothreonineCombined sources1
Modified residuei258PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei280PhosphothreonineCombined sources1
Modified residuei295PhosphoserineCombined sources1
Isoform 4 (identifier: O94875-4)
Modified residuei280PhosphothreonineCombined sources1
Modified residuei282PhosphothreonineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei326PhosphothreonineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Isoform 5 (identifier: O94875-5)
Modified residuei280PhosphothreonineCombined sourcesCurated1
Modified residuei282PhosphothreonineCombined sourcesCurated1
Modified residuei304PhosphoserineCombined sourcesCurated1
Modified residuei306PhosphoserineCombined sourcesCurated1
Modified residuei326PhosphothreonineCombined sourcesCurated1
Modified residuei341PhosphoserineCombined sourcesCurated1
Isoform 8 (identifier: O94875-8)
Modified residuei311PhosphoserineCombined sources1
Isoform 2 (identifier: O94875-2)
Modified residuei316PhosphoserineCombined sourcesCurated1
Isoform 10 (identifier: O94875-10)
Modified residuei413PhosphothreonineCombined sourcesCurated1
Modified residuei415PhosphothreonineCombined sourcesCurated1
Modified residuei437PhosphoserineCombined sourcesCurated1
Modified residuei439PhosphoserineCombined sourcesCurated1
Modified residuei459PhosphothreonineCombined sourcesCurated1
Modified residuei474PhosphoserineCombined sourcesCurated1

Post-translational modificationi

Ubiquitinated by CBL.2 Publications
Dephosphorylated by PTPN12.1 Publication

Keywords - PTMi

Amidation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO94875
MaxQBiO94875
PaxDbiO94875
PeptideAtlasiO94875
PRIDEiO94875
ProteomicsDBi50512
50513 [O94875-2]
50514 [O94875-3]
50515 [O94875-4]
50516 [O94875-5]
50517 [O94875-6]
50518 [O94875-7]

PTM databases

iPTMnetiO94875
PhosphoSitePlusiO94875

Expressioni

Tissue specificityi

Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells. In the pancreas, mainly expressed in acinar cells, duct cells and all cell types in islets (at protein level). Tends to be down-regulated in pancreatic adenocarcinomas ans metastases.3 Publications

Gene expression databases

BgeeiENSG00000154556 Expressed in 225 organ(s), highest expression level in popliteal artery
CleanExiHS_SORBS2
ExpressionAtlasiO94875 baseline and differential
GenevisibleiO94875 HS

Organism-specific databases

HPAiHPA036754
HPA036755

Interactioni

Subunit structurei

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, AFDN, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, and WASF (By similarity). Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, AKT1, CBL, PALLD and PAK1. Interacts with PTPN12 and WASF1 via its SH3 domains; this interaction may mediate the partial PTPN12 and WASF1 translocation to focal adhesion sites.By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114047, 58 interactors
CORUMiO94875
DIPiDIP-31634N
IntActiO94875, 58 interactors
MINTiO94875
STRINGi9606.ENSP00000284776

Structurei

Secondary structure

11100
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO94875
SMRiO94875
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini66 – 127SoHoPROSITE-ProRule annotationAdd BLAST62
Domaini863 – 922SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini938 – 999SH3 2PROSITE-ProRule annotationAdd BLAST62
Domaini1041 – 1100SH3 3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi167 – 182Pro-richAdd BLAST16
Compositional biasi640 – 652His-richAdd BLAST13
Compositional biasi931 – 934Poly-Pro4

Domaini

The first 2 SH3 domains are required for WASF1-binding. All 3 SH3 domains can bind independently to PTPN12.1 Publication

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiENOG410IPNR Eukaryota
ENOG410XNVJ LUCA
GeneTreeiENSGT00760000119190
HOGENOMiHOG000294090
HOVERGENiHBG108509
InParanoidiO94875
OMAiCRVSQIT
OrthoDBiEOG091G01CW
PhylomeDBiO94875
TreeFamiTF320680

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type
PANTHERiPTHR45043 PTHR45043, 1 hit
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

Sequences (12+)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 30 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94875-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSYYQRPFSP SAYSLPASLN SSIVMQHGTS LDSTDTYPQH AQSLDGTTSS
60 70 80 90 100
SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT
110 120 130 140 150
MFKQIHMVHK PDDDTDMYNT PYTYNAGLYN PPYSAQSHPA AKTQTYRPLS
160 170 180 190 200
KSHSDNSPNA FKDASSPVPP PHVPPPVPPL RPRDRSSTEK HDWDPPDRKV
210 220 230 240 250
DTRKFRSEPR SIFEYEPGKS SILQHERPAS LYQSSIDRSL ERPMSSASMA
260 270 280 290 300
SDFRKRRKSE PAVGPPRGLG DQSASRTSPG RVDLPGSSTT LTKSFTSSSP
310 320 330 340 350
SSPSRAKGGD DSKICPSLCS YSGLNGNPSS ELDYCSTYRQ HLDVPRDSPR
360 370 380 390 400
AISFKNGWQM ARQNAEIWSS TEETVSPKIK SRSCDDLLND DCDSFPDPKV
410 420 430 440 450
KSESMGSLLC EEDSKESCPM AWGSPYVPEV RSNGRSRIRH RSARNAPGFL
460 470 480 490 500
KMYKKMHRIN RKDLMNSEVI CSVKSRILQY ESEQQHKDLL RAWSQCSTEE
510 520 530 540 550
VPRDMVPTRI SEFEKLIQKS KSMPNLGDDM LSPVTLEPPQ NGLCPKRRFS
560 570 580 590 600
IEYLLEEENQ SGPPARGRRG CQSNALVPIH IEVTSDEQPR AHVEFSDSDQ
610 620 630 640 650
DGVVSDHSDY IHLEGSSFCS ESDFDHFSFT SSESFYGSSH HHHHHHHHHH
660 670 680 690 700
RHLISSCKGR CPASYTRFTT MLKHERARHE NTEEPRRQEM DPGLSKLAFL
710 720 730 740 750
VSPVPFRRKK NSAPKKQTEK AKCKASVFEA LDSALKDICD QIKAEKKRGS
760 770 780 790 800
LPDNSILHRL ISELLPDVPE RNSSLRALRR SPLHQPLHPL PPDGAIHCPP
810 820 830 840 850
YQNDCGRMPR SASFQDVDTA NSSCHHQDRG GALQDRESPR SYSSTLTDMG
860 870 880 890 900
RSAPRERRGT PEKEKLPAKA VYDFKAQTSK ELSFKKGDTV YILRKIDQNW
910 920 930 940 950
YEGEHHGRVG IFPISYVEKL TPPEKAQPAR PPPPAQPGEI GEAIAKYNFN
960 970 980 990 1000
ADTNVELSLR KGDRVILLKR VDQNWYEGKI PGTNRQGIFP VSYVEVVKKN
1010 1020 1030 1040 1050
TKGAEDYPDP PIPHSYSSDR IHSLSSNKPQ RPVFTHENIQ GGGEPFQALY
1060 1070 1080 1090 1100
NYTPRNEDEL ELRESDVIDV MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL
Length:1,100
Mass (Da):124,108
Last modified:July 22, 2008 - v3
Checksum:i7E98B196D4DB38E6
GO
Isoform 2 (identifier: O94875-2) [UniParc]FASTAAdd to basket
Also known as: ArgBP2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:666
Mass (Da):74,778
Checksum:i92504C18534CD94B
GO
Isoform 3 (identifier: O94875-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:645
Mass (Da):71,899
Checksum:i8CDEF6E34D5F972F
GO
Isoform 4 (identifier: O94875-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:691
Mass (Da):76,712
Checksum:i1CF7D8E8E49233B8
GO
Isoform 5 (identifier: O94875-5) [UniParc]FASTAAdd to basket
Also known as: ArgBP2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
     1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT

Show »
Length:645
Mass (Da):71,170
Checksum:i455C7808CED30D41
GO
Isoform 6 (identifier: O94875-6) [UniParc]FASTAAdd to basket
Also known as: Sorbin

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-89: GIPTAIRT → MKATTPLQ
     229-237: ASLYQSSID → VSKPQAGRR
     238-1100: Missing.

Show »
Length:156
Mass (Da):17,976
Checksum:i95AE8B49881FCC12
GO
Isoform 7 (identifier: O94875-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ
     112-126: Missing.

Note: No experimental confirmation available.
Show »
Length:1,004
Mass (Da):113,555
Checksum:i1D2245E4FC6037EB
GO
Isoform 8 (identifier: O94875-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:661
Mass (Da):73,868
Checksum:iD72A9CE26ADB7BAD
GO
Isoform 9 (identifier: O94875-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     112-126: Missing.
     308-834: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:644
Mass (Da):71,686
Checksum:i19886F6C073CEB1E
GO
Isoform 10 (identifier: O94875-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYSNEDSRQT...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available.Combined sourcesCurated
Show »
Length:824
Mass (Da):91,277
Checksum:iEB10B42B47D6751B
GO
Isoform 11 (identifier: O94875-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTDSGGCAR...GNSGGAVSPM

Show »
Length:1,200
Mass (Da):134,594
Checksum:i836875AFD6649C8B
GO
Isoform 12 (identifier: O94875-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:731
Mass (Da):80,966
Checksum:iC98B891C2124E1F7
GO

Computationally mapped potential isoform sequencesi

There are 30 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXR3H7BXR3_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
636Annotation score:
H7C1R7H7C1R7_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
291Annotation score:
C9IZ89C9IZ89_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
100Annotation score:
H7BZK1H7BZK1_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
291Annotation score:
C9J3W4C9J3W4_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
89Annotation score:
C9JL62C9JL62_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
93Annotation score:
C9JDX2C9JDX2_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
116Annotation score:
C9J348C9J348_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
119Annotation score:
C9JFS9C9JFS9_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
120Annotation score:
C9JC90C9JC90_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
121Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAA34497 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti73P → L in AK225327 (Ref. 5) Curated1
Sequence conflicti206R → Q in AK225327 (Ref. 5) Curated1
Sequence conflicti231L → S in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti536L → P in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti891Y → N in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti1034F → L in BAH11501 (PubMed:14702039).Curated1
Isoform 2 (identifier: O94875-2)
Sequence conflicti13A → P in AAC05509 (PubMed:9211900).Combined sourcesCurated1
Isoform 5 (identifier: O94875-5)
Sequence conflicti13A → P in AAC05508 (PubMed:9211900).Combined sourcesCurated1
Isoform 10 (identifier: O94875-10)
Sequence conflicti424K → E in AK225812 (Ref. 5) Combined sourcesCurated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0456241048A → V. Corresponds to variant dbSNP:rs725185Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0436651 – 89MSYYQ…TAIRT → MKATTPLQ in isoform 7. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0347911 – 81Missing in isoform 6. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_0462201M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10. 1 Publication1
Alternative sequenceiVSP_0470561M → MNTDSGGCARKRAAMSVTLT SVKRVQSSPNLLAAGRDSQS PDSAWRSYNDGNQETLNGDA TYSSLAAKGFRSVRPNLQDK RSPTQSQITVNGNSGGAVSP M in isoform 11. 1 Publication1
Alternative sequenceiVSP_0347921M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_0456401M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8. 1 Publication1
Alternative sequenceiVSP_0462191M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9 and isoform 12. 1 Publication1
Alternative sequenceiVSP_03479382 – 89GIPTAIRT → MKATTPLQ in isoform 6. 1 Publication8
Alternative sequenceiVSP_043666112 – 126Missing in isoform 7 and isoform 9. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_034794228P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. 1 Publication1
Alternative sequenceiVSP_034795228P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5, isoform 10 and isoform 12. 3 Publications1
Alternative sequenceiVSP_045641228P → PPPKKPLDYVQDHSSGVFNE in isoform 8. 1 Publication1
Alternative sequenceiVSP_034796229 – 237ASLYQSSID → VSKPQAGRR in isoform 6. 1 Publication9
Alternative sequenceiVSP_034797238 – 1100Missing in isoform 6. 1 PublicationAdd BLAST863
Alternative sequenceiVSP_034798308 – 834Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9, isoform 10 and isoform 12. 4 PublicationsAdd BLAST527
Alternative sequenceiVSP_0347991050 – 1100YNYTP…YVKRL → GYTLT in isoform 5. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049884 mRNA Translation: AAC05508.1
AF049885 mRNA Translation: AAC05509.1
AB018320 mRNA Translation: BAA34497.2 Different initiation.
AK056628 mRNA Translation: BAG51769.1
AK293400 mRNA Translation: BAH11501.1
AK296461 mRNA Translation: BAH12362.1
AK225327 mRNA No translation available.
AK225812 mRNA No translation available.
AC093797 Genomic DNA No translation available.
AC096659 Genomic DNA No translation available.
AC104805 Genomic DNA No translation available.
AC108472 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04630.1
CH471056 Genomic DNA Translation: EAX04631.1
CH471056 Genomic DNA Translation: EAX04632.1
CH471056 Genomic DNA Translation: EAX04635.1
CH471056 Genomic DNA Translation: EAX04636.1
BC011883 mRNA Translation: AAH11883.1
CCDSiCCDS3845.1 [O94875-1]
CCDS43289.2 [O94875-2]
CCDS47173.1 [O94875-9]
CCDS47174.1 [O94875-12]
CCDS47175.1 [O94875-10]
CCDS47176.1 [O94875-7]
CCDS54825.1 [O94875-8]
CCDS59482.1 [O94875-11]
RefSeqiNP_001139142.1, NM_001145670.1 [O94875-9]
NP_001139143.1, NM_001145671.2 [O94875-12]
NP_001139144.1, NM_001145672.1 [O94875-8]
NP_001139145.1, NM_001145673.1 [O94875-10]
NP_001139146.1, NM_001145674.1 [O94875-7]
NP_001257700.1, NM_001270771.1 [O94875-11]
NP_003594.3, NM_003603.6 [O94875-2]
NP_066547.1, NM_021069.4 [O94875-1]
XP_005263369.1, XM_005263312.1 [O94875-4]
XP_006714453.1, XM_006714390.1 [O94875-8]
XP_016864260.1, XM_017008771.1 [O94875-3]
UniGeneiHs.481342
Hs.619806
Hs.655143

Genome annotation databases

EnsembliENST00000284776; ENSP00000284776; ENSG00000154556 [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556 [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556 [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556 [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556 [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556 [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556 [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556 [O94875-9]
GeneIDi8470
KEGGihsa:8470
UCSCiuc003iyh.4 human [O94875-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049884 mRNA Translation: AAC05508.1
AF049885 mRNA Translation: AAC05509.1
AB018320 mRNA Translation: BAA34497.2 Different initiation.
AK056628 mRNA Translation: BAG51769.1
AK293400 mRNA Translation: BAH11501.1
AK296461 mRNA Translation: BAH12362.1
AK225327 mRNA No translation available.
AK225812 mRNA No translation available.
AC093797 Genomic DNA No translation available.
AC096659 Genomic DNA No translation available.
AC104805 Genomic DNA No translation available.
AC108472 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04630.1
CH471056 Genomic DNA Translation: EAX04631.1
CH471056 Genomic DNA Translation: EAX04632.1
CH471056 Genomic DNA Translation: EAX04635.1
CH471056 Genomic DNA Translation: EAX04636.1
BC011883 mRNA Translation: AAH11883.1
CCDSiCCDS3845.1 [O94875-1]
CCDS43289.2 [O94875-2]
CCDS47173.1 [O94875-9]
CCDS47174.1 [O94875-12]
CCDS47175.1 [O94875-10]
CCDS47176.1 [O94875-7]
CCDS54825.1 [O94875-8]
CCDS59482.1 [O94875-11]
RefSeqiNP_001139142.1, NM_001145670.1 [O94875-9]
NP_001139143.1, NM_001145671.2 [O94875-12]
NP_001139144.1, NM_001145672.1 [O94875-8]
NP_001139145.1, NM_001145673.1 [O94875-10]
NP_001139146.1, NM_001145674.1 [O94875-7]
NP_001257700.1, NM_001270771.1 [O94875-11]
NP_003594.3, NM_003603.6 [O94875-2]
NP_066547.1, NM_021069.4 [O94875-1]
XP_005263369.1, XM_005263312.1 [O94875-4]
XP_006714453.1, XM_006714390.1 [O94875-8]
XP_016864260.1, XM_017008771.1 [O94875-3]
UniGeneiHs.481342
Hs.619806
Hs.655143

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5VEIX-ray1.33A866-921[»]
ProteinModelPortaliO94875
SMRiO94875
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114047, 58 interactors
CORUMiO94875
DIPiDIP-31634N
IntActiO94875, 58 interactors
MINTiO94875
STRINGi9606.ENSP00000284776

PTM databases

iPTMnetiO94875
PhosphoSitePlusiO94875

Polymorphism and mutation databases

BioMutaiSORBS2

Proteomic databases

EPDiO94875
MaxQBiO94875
PaxDbiO94875
PeptideAtlasiO94875
PRIDEiO94875
ProteomicsDBi50512
50513 [O94875-2]
50514 [O94875-3]
50515 [O94875-4]
50516 [O94875-5]
50517 [O94875-6]
50518 [O94875-7]

Protocols and materials databases

DNASUi8470
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000284776; ENSP00000284776; ENSG00000154556 [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556 [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556 [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556 [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556 [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556 [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556 [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556 [O94875-9]
GeneIDi8470
KEGGihsa:8470
UCSCiuc003iyh.4 human [O94875-1]

Organism-specific databases

CTDi8470
DisGeNETi8470
EuPathDBiHostDB:ENSG00000154556.17
GeneCardsiSORBS2
HGNCiHGNC:24098 SORBS2
HPAiHPA036754
HPA036755
MIMi616349 gene
neXtProtiNX_O94875
OpenTargetsiENSG00000154556
PharmGKBiPA142670890
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPNR Eukaryota
ENOG410XNVJ LUCA
GeneTreeiENSGT00760000119190
HOGENOMiHOG000294090
HOVERGENiHBG108509
InParanoidiO94875
OMAiCRVSQIT
OrthoDBiEOG091G01CW
PhylomeDBiO94875
TreeFamiTF320680

Enzyme and pathway databases

SignaLinkiO94875
SIGNORiO94875

Miscellaneous databases

ChiTaRSiSORBS2 human
GeneWikiiSORBS2
GenomeRNAii8470
PROiPR:O94875
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000154556 Expressed in 225 organ(s), highest expression level in popliteal artery
CleanExiHS_SORBS2
ExpressionAtlasiO94875 baseline and differential
GenevisibleiO94875 HS

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type
PANTHERiPTHR45043 PTHR45043, 1 hit
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSRBS2_HUMAN
AccessioniPrimary (citable) accession number: O94875
Secondary accession number(s): A6NEK9
, B3KPQ7, B7Z1G5, B7Z3X6, C9JKV9, D3DP62, D3DP63, E9PAS5, E9PAW4, G3XAI0, H7BXR4, J3KNZ5, O60592, O60593, Q96EX0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: November 7, 2018
This is version 163 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again