Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (08 May 2019)
Sequence version 3 (22 Jul 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sorbin and SH3 domain-containing protein 2

Gene

SORBS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1. May play a role in the regulation of pancreatic cell adhesion, possibly by acting on WASF1 phosphorylation, enhancing phosphorylation by ABL1, as well as dephosphorylation by PTPN12 (PubMed:18559503). Isoform 6 increases water and sodium absorption in the intestine and gall-bladder.3 Publications

Caution

Was shown to interact with AKT1 and PAK1 (PubMed:15784622). This work has later been retracted due to concerns of image manipulation.1 Publication1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O94875

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O94875

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg-binding protein 2
Short name:
ArgBP2
Arg/Abl-interacting protein 2
Sorbin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SORBS2
Synonyms:ARGBP2, KIAA0777
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24098 SORBS2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616349 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O94875

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8470

Open Targets

More...
OpenTargetsi
ENSG00000154556

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670890

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SORBS2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003444771 – 1100Sorbin and SH3 domain-containing protein 2Add BLAST1100

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei30PhosphoserineBy similarity1
Modified residuei43PhosphoserineBy similarity1
Modified residuei154PhosphoserineCombined sources1
Modified residuei157PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1
Modified residuei245PhosphoserineBy similarity1
Modified residuei248PhosphoserineBy similarity1
Modified residuei259PhosphoserineCombined sources1
Modified residuei277PhosphothreonineCombined sources1
Modified residuei287PhosphoserineCombined sources1
Modified residuei292PhosphothreonineCombined sources1
Modified residuei297PhosphoserineBy similarity1
Modified residuei298PhosphoserineCombined sources1
Modified residuei299PhosphoserineCombined sources1
Modified residuei301PhosphoserineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei383PhosphoserineBy similarity1
Modified residuei494PhosphoserineBy similarity1
Modified residuei497PhosphoserineBy similarity1
Modified residuei550PhosphoserineBy similarity1
Modified residuei750PhosphoserineBy similarity1
Modified residuei843PhosphoserineCombined sources1
Modified residuei1017PhosphoserineBy similarity1
Modified residuei1023PhosphoserineCombined sources1
Isoform 9 (identifier: O94875-9)
Modified residuei13PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Isoform 12 (identifier: O94875-12)
Modified residuei13PhosphoserineCombined sources1
Modified residuei14PhosphoserineCombined sources1
Modified residuei320PhosphothreonineCombined sources1
Modified residuei322PhosphothreonineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Modified residuei366PhosphothreonineCombined sources1
Modified residuei381PhosphoserineCombined sources1
Isoform 11 (identifier: O94875-11)
Modified residuei27PhosphoserineCombined sources1
Modified residuei28PhosphoserineCombined sources1
Isoform 6 (identifier: O94875-6)
Modified residuei153Alanine amide1 Publication1
Isoform 3 (identifier: O94875-3)
Modified residuei234PhosphothreonineCombined sources1
Modified residuei236PhosphothreonineCombined sources1
Modified residuei258PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei280PhosphothreonineCombined sources1
Modified residuei295PhosphoserineCombined sources1
Isoform 4 (identifier: O94875-4)
Modified residuei280PhosphothreonineCombined sources1
Modified residuei282PhosphothreonineCombined sources1
Modified residuei304PhosphoserineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei326PhosphothreonineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Isoform 5 (identifier: O94875-5)
Modified residuei280PhosphothreonineCombined sourcesCurated1
Modified residuei282PhosphothreonineCombined sourcesCurated1
Modified residuei304PhosphoserineCombined sourcesCurated1
Modified residuei306PhosphoserineCombined sourcesCurated1
Modified residuei326PhosphothreonineCombined sourcesCurated1
Modified residuei341PhosphoserineCombined sourcesCurated1
Isoform 8 (identifier: O94875-8)
Modified residuei311PhosphoserineCombined sources1
Isoform 2 (identifier: O94875-2)
Modified residuei316PhosphoserineCombined sourcesCurated1
Isoform 10 (identifier: O94875-10)
Modified residuei413PhosphothreonineCombined sourcesCurated1
Modified residuei415PhosphothreonineCombined sourcesCurated1
Modified residuei437PhosphoserineCombined sourcesCurated1
Modified residuei439PhosphoserineCombined sourcesCurated1
Modified residuei459PhosphothreonineCombined sourcesCurated1
Modified residuei474PhosphoserineCombined sourcesCurated1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by CBL.1 Publication
Dephosphorylated by PTPN12.1 Publication

Keywords - PTMi

Amidation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O94875

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O94875

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O94875

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O94875

PeptideAtlas

More...
PeptideAtlasi
O94875

PRoteomics IDEntifications database

More...
PRIDEi
O94875

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50512
50513 [O94875-2]
50514 [O94875-3]
50515 [O94875-4]
50516 [O94875-5]
50517 [O94875-6]
50518 [O94875-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O94875

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O94875

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelial cells. In the pancreas, mainly expressed in acinar cells, duct cells and all cell types in islets (at protein level). Tends to be down-regulated in pancreatic adenocarcinomas ans metastases.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000154556 Expressed in 225 organ(s), highest expression level in popliteal artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O94875 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O94875 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036754
HPA036755

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, AFDN, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin and WASF (By similarity). Interacts with ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, CBL and PALLD. Interacts with PTPN12 and WASF1 via its SH3 domains; this interaction may mediate the partial PTPN12 and WASF1 translocation to focal adhesion sites.By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114047, 59 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O94875

Database of interacting proteins

More...
DIPi
DIP-31634N

Protein interaction database and analysis system

More...
IntActi
O94875, 59 interactors

Molecular INTeraction database

More...
MINTi
O94875

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000347852

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11100
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O94875

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini66 – 127SoHoPROSITE-ProRule annotationAdd BLAST62
Domaini863 – 922SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini938 – 999SH3 2PROSITE-ProRule annotationAdd BLAST62
Domaini1041 – 1100SH3 3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi167 – 182Pro-richAdd BLAST16
Compositional biasi640 – 652His-richAdd BLAST13
Compositional biasi931 – 934Poly-Pro4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first 2 SH3 domains are required for WASF1-binding. All 3 SH3 domains can bind independently to PTPN12.1 Publication

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPNR Eukaryota
ENOG410XNVJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157056

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294090

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O94875

Identification of Orthologs from Complete Genome Data

More...
OMAi
CRVSQIT

Database of Orthologous Groups

More...
OrthoDBi
228183at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O94875

TreeFam database of animal gene trees

More...
TreeFami
TF320680

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR14167:SF56 PTHR14167:SF56, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 31 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94875-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSYYQRPFSP SAYSLPASLN SSIVMQHGTS LDSTDTYPQH AQSLDGTTSS
60 70 80 90 100
SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT
110 120 130 140 150
MFKQIHMVHK PDDDTDMYNT PYTYNAGLYN PPYSAQSHPA AKTQTYRPLS
160 170 180 190 200
KSHSDNSPNA FKDASSPVPP PHVPPPVPPL RPRDRSSTEK HDWDPPDRKV
210 220 230 240 250
DTRKFRSEPR SIFEYEPGKS SILQHERPAS LYQSSIDRSL ERPMSSASMA
260 270 280 290 300
SDFRKRRKSE PAVGPPRGLG DQSASRTSPG RVDLPGSSTT LTKSFTSSSP
310 320 330 340 350
SSPSRAKGGD DSKICPSLCS YSGLNGNPSS ELDYCSTYRQ HLDVPRDSPR
360 370 380 390 400
AISFKNGWQM ARQNAEIWSS TEETVSPKIK SRSCDDLLND DCDSFPDPKV
410 420 430 440 450
KSESMGSLLC EEDSKESCPM AWGSPYVPEV RSNGRSRIRH RSARNAPGFL
460 470 480 490 500
KMYKKMHRIN RKDLMNSEVI CSVKSRILQY ESEQQHKDLL RAWSQCSTEE
510 520 530 540 550
VPRDMVPTRI SEFEKLIQKS KSMPNLGDDM LSPVTLEPPQ NGLCPKRRFS
560 570 580 590 600
IEYLLEEENQ SGPPARGRRG CQSNALVPIH IEVTSDEQPR AHVEFSDSDQ
610 620 630 640 650
DGVVSDHSDY IHLEGSSFCS ESDFDHFSFT SSESFYGSSH HHHHHHHHHH
660 670 680 690 700
RHLISSCKGR CPASYTRFTT MLKHERARHE NTEEPRRQEM DPGLSKLAFL
710 720 730 740 750
VSPVPFRRKK NSAPKKQTEK AKCKASVFEA LDSALKDICD QIKAEKKRGS
760 770 780 790 800
LPDNSILHRL ISELLPDVPE RNSSLRALRR SPLHQPLHPL PPDGAIHCPP
810 820 830 840 850
YQNDCGRMPR SASFQDVDTA NSSCHHQDRG GALQDRESPR SYSSTLTDMG
860 870 880 890 900
RSAPRERRGT PEKEKLPAKA VYDFKAQTSK ELSFKKGDTV YILRKIDQNW
910 920 930 940 950
YEGEHHGRVG IFPISYVEKL TPPEKAQPAR PPPPAQPGEI GEAIAKYNFN
960 970 980 990 1000
ADTNVELSLR KGDRVILLKR VDQNWYEGKI PGTNRQGIFP VSYVEVVKKN
1010 1020 1030 1040 1050
TKGAEDYPDP PIPHSYSSDR IHSLSSNKPQ RPVFTHENIQ GGGEPFQALY
1060 1070 1080 1090 1100
NYTPRNEDEL ELRESDVIDV MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL
Length:1,100
Mass (Da):124,108
Last modified:July 22, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7E98B196D4DB38E6
GO
Isoform 2 (identifier: O94875-2) [UniParc]FASTAAdd to basket
Also known as: ArgBP2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PTDRINPDDIDLENEPWYKFFSELEFGRPPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:666
Mass (Da):74,778
Checksum:i92504C18534CD94B
GO
Isoform 3 (identifier: O94875-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:645
Mass (Da):71,899
Checksum:i8CDEF6E34D5F972F
GO
Isoform 4 (identifier: O94875-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:691
Mass (Da):76,712
Checksum:i1CF7D8E8E49233B8
GO
Isoform 5 (identifier: O94875-5) [UniParc]FASTAAdd to basket
Also known as: ArgBP2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.
     1050-1100: YNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → GYTLT

Show »
Length:645
Mass (Da):71,170
Checksum:i455C7808CED30D41
GO
Isoform 6 (identifier: O94875-6) [UniParc]FASTAAdd to basket
Also known as: Sorbin

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     82-89: GIPTAIRT → MKATTPLQ
     229-237: ASLYQSSID → VSKPQAGRR
     238-1100: Missing.

Show »
Length:156
Mass (Da):17,976
Checksum:i95AE8B49881FCC12
GO
Isoform 7 (identifier: O94875-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSYYQRPFSP...ESGIPTAIRT → MKATTPLQ
     112-126: Missing.

Note: No experimental confirmation available.
Show »
Length:1,004
Mass (Da):113,555
Checksum:i1D2245E4FC6037EB
GO
Isoform 8 (identifier: O94875-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTGRDSQSPDSAWRSYNDGNQETLNGDATYSSLAAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPM
     228-228: P → PPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:661
Mass (Da):73,868
Checksum:iD72A9CE26ADB7BAD
GO
Isoform 9 (identifier: O94875-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     112-126: Missing.
     308-834: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:644
Mass (Da):71,686
Checksum:i19886F6C073CEB1E
GO
Isoform 10 (identifier: O94875-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MYSNEDSRQT...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Note: No experimental confirmation available.Combined sourcesCurated
Show »
Length:824
Mass (Da):91,277
Checksum:iEB10B42B47D6751B
GO
Isoform 11 (identifier: O94875-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNTDSGGCAR...GNSGGAVSPM

Show »
Length:1,200
Mass (Da):134,594
Checksum:i836875AFD6649C8B
GO
Isoform 12 (identifier: O94875-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSVTLTSVKR...GNSGGAVSPM
     228-228: P → PPPLPTTPTPVPREPGRKPLSSSRLGEVTGSPSPPPRSGAPTPSSRAPALSPTRPPKKPLDYVQDHSSGVFNE
     308-834: Missing.

Show »
Length:731
Mass (Da):80,966
Checksum:iC98B891C2124E1F7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 31 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXR3H7BXR3_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
636Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1R7H7C1R7_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZ89C9IZ89_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZK1H7BZK1_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3W4C9J3W4_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JL62C9JL62_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZX1H7BZX1_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J348C9J348_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JDX2C9JDX2_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JC90C9JC90_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS2
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34497 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti73P → L in AK225327 (Ref. 5) Curated1
Sequence conflicti206R → Q in AK225327 (Ref. 5) Curated1
Sequence conflicti231L → S in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti536L → P in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti891Y → N in BAG51769 (PubMed:14702039).Curated1
Sequence conflicti1034F → L in BAH11501 (PubMed:14702039).Curated1
Isoform 2 (identifier: O94875-2)
Sequence conflicti13A → P in AAC05509 (PubMed:9211900).Combined sourcesCurated1
Isoform 5 (identifier: O94875-5)
Sequence conflicti13A → P in AAC05508 (PubMed:9211900).Combined sourcesCurated1
Isoform 10 (identifier: O94875-10)
Sequence conflicti424K → E in AK225812 (Ref. 5) Combined sourcesCurated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0456241048A → V. Corresponds to variant dbSNP:rs725185Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0436651 – 89MSYYQ…TAIRT → MKATTPLQ in isoform 7. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0347911 – 81Missing in isoform 6. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_0462201M → MYSNEDSRQTIVYSEESNTT MSYTQKITNPLPAASSTDPA PFANINTPVLQEDYRQDSQT RRISTLKLTHNQDLGSSSPI STPQFSKSVEVPSFLKRPRS LTPNPVPETHTASLSIQIAP LSGQDLESHKQLPELSPETA KIPLQQERQKSAVAAASQSS DCRVSQITVNGNSGGAVSPM in isoform 10. 1 Publication1
Alternative sequenceiVSP_0470561M → MNTDSGGCARKRAAMSVTLT SVKRVQSSPNLLAAGRDSQS PDSAWRSYNDGNQETLNGDA TYSSLAAKGFRSVRPNLQDK RSPTQSQITVNGNSGGAVSP M in isoform 11. 1 Publication1
Alternative sequenceiVSP_0347921M → MNTGRDSQSPDSAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 2, isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_0456401M → MNTGRDSQSPDSAWRSYNDG NQETLNGDATYSSLAAKGFR SVRPNLQDKRSPTQSQITVN GNSGGAVSPM in isoform 8. 1 Publication1
Alternative sequenceiVSP_0462191M → MSVTLTSVKRVQSSPNLLAA GRDSQSPDSAWRSYNDGNQE TLNGDATYSSLAAKGFRSVR PNLQDKRSPTQSQITVNGNS GGAVSPM in isoform 9 and isoform 12. 1 Publication1
Alternative sequenceiVSP_03479382 – 89GIPTAIRT → MKATTPLQ in isoform 6. 1 Publication8
Alternative sequenceiVSP_043666112 – 126Missing in isoform 7 and isoform 9. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_034794228P → PTDRINPDDIDLENEPWYKF FSELEFGRPPPKKPLDYVQD HSSGVFNE in isoform 2. 1 Publication1
Alternative sequenceiVSP_034795228P → PPPLPTTPTPVPREPGRKPL SSSRLGEVTGSPSPPPRSGA PTPSSRAPALSPTRPPKKPL DYVQDHSSGVFNE in isoform 3, isoform 4, isoform 5, isoform 10 and isoform 12. 3 Publications1
Alternative sequenceiVSP_045641228P → PPPKKPLDYVQDHSSGVFNE in isoform 8. 1 Publication1
Alternative sequenceiVSP_034796229 – 237ASLYQSSID → VSKPQAGRR in isoform 6. 1 Publication9
Alternative sequenceiVSP_034797238 – 1100Missing in isoform 6. 1 PublicationAdd BLAST863
Alternative sequenceiVSP_034798308 – 834Missing in isoform 2, isoform 3, isoform 4, isoform 5, isoform 8, isoform 9, isoform 10 and isoform 12. 4 PublicationsAdd BLAST527
Alternative sequenceiVSP_0347991050 – 1100YNYTP…YVKRL → GYTLT in isoform 5. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF049884 mRNA Translation: AAC05508.1
AF049885 mRNA Translation: AAC05509.1
AB018320 mRNA Translation: BAA34497.2 Different initiation.
AK056628 mRNA Translation: BAG51769.1
AK293400 mRNA Translation: BAH11501.1
AK296461 mRNA Translation: BAH12362.1
AK225327 mRNA No translation available.
AK225812 mRNA No translation available.
AC093797 Genomic DNA No translation available.
AC096659 Genomic DNA No translation available.
AC104805 Genomic DNA No translation available.
AC108472 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04630.1
CH471056 Genomic DNA Translation: EAX04631.1
CH471056 Genomic DNA Translation: EAX04632.1
CH471056 Genomic DNA Translation: EAX04635.1
CH471056 Genomic DNA Translation: EAX04636.1
BC011883 mRNA Translation: AAH11883.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3845.1 [O94875-1]
CCDS43289.2 [O94875-2]
CCDS47173.1 [O94875-9]
CCDS47174.1 [O94875-12]
CCDS47175.1 [O94875-10]
CCDS47176.1 [O94875-7]
CCDS54825.1 [O94875-8]
CCDS59482.1 [O94875-11]

NCBI Reference Sequences

More...
RefSeqi
NP_001139142.1, NM_001145670.1 [O94875-9]
NP_001139143.1, NM_001145671.2 [O94875-12]
NP_001139144.1, NM_001145672.1 [O94875-8]
NP_001139145.1, NM_001145673.1 [O94875-10]
NP_001139146.1, NM_001145674.1 [O94875-7]
NP_001257700.1, NM_001270771.1 [O94875-11]
NP_003594.3, NM_003603.6 [O94875-2]
NP_066547.1, NM_021069.4 [O94875-1]
XP_005263369.1, XM_005263312.1 [O94875-4]
XP_006714453.1, XM_006714390.1 [O94875-8]
XP_016864260.1, XM_017008771.1 [O94875-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000284776; ENSP00000284776; ENSG00000154556 [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556 [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556 [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556 [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556 [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556 [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556 [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556 [O94875-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8470

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8470

UCSC genome browser

More...
UCSCi
uc003iyh.4 human [O94875-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049884 mRNA Translation: AAC05508.1
AF049885 mRNA Translation: AAC05509.1
AB018320 mRNA Translation: BAA34497.2 Different initiation.
AK056628 mRNA Translation: BAG51769.1
AK293400 mRNA Translation: BAH11501.1
AK296461 mRNA Translation: BAH12362.1
AK225327 mRNA No translation available.
AK225812 mRNA No translation available.
AC093797 Genomic DNA No translation available.
AC096659 Genomic DNA No translation available.
AC104805 Genomic DNA No translation available.
AC108472 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04630.1
CH471056 Genomic DNA Translation: EAX04631.1
CH471056 Genomic DNA Translation: EAX04632.1
CH471056 Genomic DNA Translation: EAX04635.1
CH471056 Genomic DNA Translation: EAX04636.1
BC011883 mRNA Translation: AAH11883.1
CCDSiCCDS3845.1 [O94875-1]
CCDS43289.2 [O94875-2]
CCDS47173.1 [O94875-9]
CCDS47174.1 [O94875-12]
CCDS47175.1 [O94875-10]
CCDS47176.1 [O94875-7]
CCDS54825.1 [O94875-8]
CCDS59482.1 [O94875-11]
RefSeqiNP_001139142.1, NM_001145670.1 [O94875-9]
NP_001139143.1, NM_001145671.2 [O94875-12]
NP_001139144.1, NM_001145672.1 [O94875-8]
NP_001139145.1, NM_001145673.1 [O94875-10]
NP_001139146.1, NM_001145674.1 [O94875-7]
NP_001257700.1, NM_001270771.1 [O94875-11]
NP_003594.3, NM_003603.6 [O94875-2]
NP_066547.1, NM_021069.4 [O94875-1]
XP_005263369.1, XM_005263312.1 [O94875-4]
XP_006714453.1, XM_006714390.1 [O94875-8]
XP_016864260.1, XM_017008771.1 [O94875-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5VEIX-ray1.33A866-921[»]
SMRiO94875
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114047, 59 interactors
CORUMiO94875
DIPiDIP-31634N
IntActiO94875, 59 interactors
MINTiO94875
STRINGi9606.ENSP00000347852

PTM databases

iPTMnetiO94875
PhosphoSitePlusiO94875

Polymorphism and mutation databases

BioMutaiSORBS2

Proteomic databases

EPDiO94875
jPOSTiO94875
MaxQBiO94875
PaxDbiO94875
PeptideAtlasiO94875
PRIDEiO94875
ProteomicsDBi50512
50513 [O94875-2]
50514 [O94875-3]
50515 [O94875-4]
50516 [O94875-5]
50517 [O94875-6]
50518 [O94875-7]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8470
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000284776; ENSP00000284776; ENSG00000154556 [O94875-1]
ENST00000319471; ENSP00000322182; ENSG00000154556 [O94875-12]
ENST00000355634; ENSP00000347852; ENSG00000154556 [O94875-11]
ENST00000393528; ENSP00000377162; ENSG00000154556 [O94875-2]
ENST00000418609; ENSP00000397482; ENSG00000154556 [O94875-7]
ENST00000437304; ENSP00000396008; ENSG00000154556 [O94875-10]
ENST00000448662; ENSP00000409158; ENSG00000154556 [O94875-8]
ENST00000449407; ENSP00000397262; ENSG00000154556 [O94875-9]
GeneIDi8470
KEGGihsa:8470
UCSCiuc003iyh.4 human [O94875-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8470
DisGeNETi8470

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SORBS2
HGNCiHGNC:24098 SORBS2
HPAiHPA036754
HPA036755
MIMi616349 gene
neXtProtiNX_O94875
OpenTargetsiENSG00000154556
PharmGKBiPA142670890

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IPNR Eukaryota
ENOG410XNVJ LUCA
GeneTreeiENSGT00940000157056
HOGENOMiHOG000294090
InParanoidiO94875
OMAiCRVSQIT
OrthoDBi228183at2759
PhylomeDBiO94875
TreeFamiTF320680

Enzyme and pathway databases

SignaLinkiO94875
SIGNORiO94875

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SORBS2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SORBS2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8470

Protein Ontology

More...
PROi
PR:O94875

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000154556 Expressed in 225 organ(s), highest expression level in popliteal artery
ExpressionAtlasiO94875 baseline and differential
GenevisibleiO94875 HS

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type
PANTHERiPTHR14167:SF56 PTHR14167:SF56, 2 hits
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRBS2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94875
Secondary accession number(s): A6NEK9
, B3KPQ7, B7Z1G5, B7Z3X6, C9JKV9, D3DP62, D3DP63, E9PAS5, E9PAW4, G3XAI0, H7BXR4, J3KNZ5, O60592, O60593, Q96EX0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: May 8, 2019
This is version 168 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again