Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family G member 5

Gene

PLEKHG5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor that activates RHOA and maybe the NF-kappa-B signaling pathway. Involved in the control of neuronal cell differentiation. Plays a role in angiogenesis through regulation of endothelial cells chemotaxis.2 Publications

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family G member 5
Short name:
PH domain-containing family G member 5
Alternative name(s):
Guanine nucleotide exchange factor 720
Short name:
GEF720
Gene namesi
Name:PLEKHG5
Synonyms:KIAA0720
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000171680.20
HGNCiHGNC:29105 PLEKHG5
MIMi611101 gene
neXtProtiNX_O94827

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Distal spinal muscular atrophy, autosomal recessive, 4 (DSMA4)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neuromuscular disorder. Distal spinal muscular atrophy, also known as distal hereditary motor neuronopathy, represents a heterogeneous group of neuromuscular disorders caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. DSMA4 is characterized by childhood onset, generalized muscle weakness and atrophy with denervation and normal sensation. Bulbar symptoms and pyramidal signs are absent.
See also OMIM:611067
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035357703F → S in DSMA4; stability and intracellular location affected severely impairing the NF-kappa-B transduction pathway. 1 PublicationCorresponds to variant dbSNP:rs63750315Ensembl.1
Charcot-Marie-Tooth disease, recessive, intermediate type, C (CMTRIC)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Recessive intermediate forms of Charcot-Marie-Tooth disease are characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
See also OMIM:615376
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_070217719T → M in CMTRIC; in vitro assay suggests a defect in activating the NF-kappa-B signaling pathway. 1 PublicationCorresponds to variant dbSNP:rs397515456Ensembl.1
Natural variantiVAR_070218876G → R in CMTRIC; in vitro assay suggests a defect in activating the NF-kappa-B signaling pathway. 1 PublicationCorresponds to variant dbSNP:rs202191898Ensembl.1

Keywords - Diseasei

Charcot-Marie-Tooth disease, Disease mutation, Neurodegeneration, Neuropathy

Organism-specific databases

DisGeNETi57449
MalaCardsiPLEKHG5
MIMi611067 phenotype
615376 phenotype
OpenTargetsiENSG00000171680
Orphaneti369867 Autosomal recessive intermediate Charcot-Marie-Tooth disease type C
206580 Autosomal recessive lower motor neuron disease with childhood onset
PharmGKBiPA142671164

Polymorphism and mutation databases

BioMutaiPLEKHG5

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003071341 – 1062Pleckstrin homology domain-containing family G member 5Add BLAST1062

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei785PhosphothreonineBy similarity1
Modified residuei790PhosphoserineBy similarity1
Modified residuei907PhosphoserineBy similarity1
Modified residuei932PhosphoserineBy similarity1
Modified residuei937PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO94827
PaxDbiO94827
PeptideAtlasiO94827
PRIDEiO94827
ProteomicsDBi50469
50470 [O94827-2]
50471 [O94827-3]
50472 [O94827-4]
50473 [O94827-5]

PTM databases

iPTMnetiO94827
PhosphoSitePlusiO94827

Expressioni

Tissue specificityi

Predominantly expressed in the peripheral nervous system and brain. Highest expression is observed in heart, lung, kidney, testis and moderate expression is present in spleen, pancreas, skeletal muscle, ovary and liver. Weakly expressed in glioblastoma (GBM) cell lines.3 Publications

Gene expression databases

BgeeiENSG00000171680 Expressed in 123 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_PLEKHG5
ExpressionAtlasiO94827 baseline and differential
GenevisibleiO94827 HS

Organism-specific databases

HPAiHPA049570

Interactioni

Subunit structurei

Interacts with GIPC1/synectin and RHOA.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121522, 16 interactors
IntActiO94827, 3 interactors
STRINGi9606.ENSP00000366977

Structurei

3D structure databases

ProteinModelPortaliO94827
SMRiO94827
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini392 – 584DHPROSITE-ProRule annotationAdd BLAST193
Domaini640 – 740PHPROSITE-ProRule annotationAdd BLAST101

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi94 – 99Poly-Glu6
Compositional biasi761 – 781Glu-richAdd BLAST21

Phylogenomic databases

eggNOGiKOG3521 Eukaryota
ENOG410XRPT LUCA
GeneTreeiENSGT00510000046843
HOGENOMiHOG000049145
HOVERGENiHBG058106
InParanoidiO94827
KOiK19464
OMAiGISAQHR
OrthoDBiEOG091G00RK
PhylomeDBiO94827
TreeFamiTF316755

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94827-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDDQSPAEKK GLRCQNPACM DKGRAAKVCH HADCQQLHRR GPLNLCEACD
60 70 80 90 100
SKFHSTMHYD GHVRFDLPPQ GSVLARNVST RSCPPRTSPA VDLEEEEEES
110 120 130 140 150
SVDGKGDRKS TGLKLSKKKA RRRHTDDPSK ECFTLKFDLN VDIETEIVPA
160 170 180 190 200
MKKKSLGEVL LPVFERKGIA LGKVDIYLDQ SNTPLSLTFE AYRFGGHYLR
210 220 230 240 250
VKAPAKPGDE GKVEQGMKDS KSLSLPILRP AGTGPPALER VDAQSRRESL
260 270 280 290 300
DILAPGRRRK NMSEFLGEAS IPGQEPPTPS SCSLPSGSSG STNTGDSWKN
310 320 330 340 350
RAASRFSGFF SSGPSTSAFG REVDKMEQLE GKLHTYSLFG LPRLPRGLRF
360 370 380 390 400
DHDSWEEEYD EDEDEDNACL RLEDSWRELI DGHEKLTRRQ CHQQEAVWEL
410 420 430 440 450
LHTEASYIRK LRVIINLFLC CLLNLQESGL LCEVEAERLF SNIPEIAQLH
460 470 480 490 500
RRLWASVMAP VLEKARRTRA LLQPGDFLKG FKMFGSLFKP YIRYCMEEEG
510 520 530 540 550
CMEYMRGLLR DNDLFRAYIT WAEKHPQCQR LKLSDMLAKP HQRLTKYPLL
560 570 580 590 600
LKSVLRKTEE PRAKEAVVAM IGSVERFIHH VNACMRQRQE RQRLAAVVSR
610 620 630 640 650
IDAYEVVESS SDEVDKLLKE FLHLDLTAPI PGASPEETRQ LLLEGSLRMK
660 670 680 690 700
EGKDSKMDVY CFLFTDLLLV TKAVKKAERT RVIRPPLLVD KIVCRELRDP
710 720 730 740 750
GSFLLIYLNE FHSAVGAYTF QASGQALCRG WVDTIYNAQN QLQQLRAQEP
760 770 780 790 800
PGSQQPLQSL EEEEDEQEEE EEEEEEEEEG EDSGTSAASS PTIMRKSSGS
810 820 830 840 850
PDSQHCASDG STETLAMVVV EPGDTLSSPE FDSGPFSSQS DETSLSTTAS
860 870 880 890 900
SATPTSELLP LGPVDGRSCS MDSAYGTLSP TSLQDFVAPG PMAELVPRAP
910 920 930 940 950
ESPRVPSPPP SPRLRRRTPV QLLSCPPHLL KSKSEASLLQ LLAGAGTHGT
960 970 980 990 1000
PSAPSRSLSE LCLAVPAPGI RTQGSPQEAG PSWDCRGAPS PGSGPGLVGC
1010 1020 1030 1040 1050
LAGEPAGSHR KRCGDLPSGA SPRVQPEPPP GVSAQHRKLT LAQLYRIRTT
1060
LLLNSTLTAS EV
Length:1,062
Mass (Da):117,451
Last modified:October 23, 2007 - v3
Checksum:i20746D577B67B23F
GO
Isoform 2 (identifier: O94827-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNSVLTKHGSPPRSWLSLCSGT

Note: No experimental confirmation available.
Show »
Length:1,083
Mass (Da):119,660
Checksum:i180C84118EB41D57
GO
Isoform 3 (identifier: O94827-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.

Note: No experimental confirmation available.
Show »
Length:1,043
Mass (Da):115,378
Checksum:i561BF06557096D6C
GO
Isoform 4 (identifier: O94827-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.
     969-986: GIRTQGSPQEAGPSWDCR → AQEADPGPALPNQDHPAA
     987-1062: Missing.

Note: No experimental confirmation available.
Show »
Length:930
Mass (Da):103,364
Checksum:i8938A81803D1B6FD
GO
Isoform 5 (identifier: O94827-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.

Note: No experimental confirmation available.
Show »
Length:1,006
Mass (Da):111,231
Checksum:i2260D175D3C27D76
GO
Isoform 6 (identifier: O94827-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MD → MSLGERGSPQTFGGSSVSKGSDAGH

Note: No experimental confirmation available.
Show »
Length:1,085
Mass (Da):119,623
Checksum:iF4199F780D2F945A
GO
Isoform 7 (identifier: O94827-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MDDQSPAEKKGLRCQNPACMDKGRAAK → MGTGPGVSGRLAASRPGPGLPLRDSEPSWAGGRARDGDSQ

Note: No experimental confirmation available.Curated
Show »
Length:1,075
Mass (Da):118,479
Checksum:iFEC80DA35C9023F7
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5SY18Q5SY18_HUMAN
Pleckstrin homology domain-containi...
PLEKHG5
852Annotation score:
A0A1W2PPJ8A0A1W2PPJ8_HUMAN
Pleckstrin homology domain-containi...
PLEKHG5
70Annotation score:

Sequence cautioni

The sequence BAA34440 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC77354 differs from that shown. Aberrant splicing.Curated
The sequence BAC85124 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti162P → L in BAH11909 (PubMed:14702039).Curated1
Sequence conflicti294T → S in BAA34440 (PubMed:9872452).Curated1
Sequence conflicti570M → T in BAG53269 (PubMed:14702039).Curated1
Sequence conflicti637E → G in BAC77354 (PubMed:12761501).Curated1
Sequence conflicti778 – 779Missing in BAC77354 (PubMed:12761501).Curated2
Sequence conflicti960E → G in BAG53269 (PubMed:14702039).Curated1
Isoform 7 (identifier: O94827-7)
Sequence conflicti38D → E in BAH13058 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035357703F → S in DSMA4; stability and intracellular location affected severely impairing the NF-kappa-B transduction pathway. 1 PublicationCorresponds to variant dbSNP:rs63750315Ensembl.1
Natural variantiVAR_070217719T → M in CMTRIC; in vitro assay suggests a defect in activating the NF-kappa-B signaling pathway. 1 PublicationCorresponds to variant dbSNP:rs397515456Ensembl.1
Natural variantiVAR_070218876G → R in CMTRIC; in vitro assay suggests a defect in activating the NF-kappa-B signaling pathway. 1 PublicationCorresponds to variant dbSNP:rs202191898Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0369861 – 56Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_0459641 – 27MDDQS…GRAAK → MGTGPGVSGRLAASRPGPGL PLRDSEPSWAGGRARDGDSQ in isoform 7. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_0285831 – 19Missing in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0447461 – 2MD → MSLGERGSPQTFGGSSVSKG SDAGH in isoform 6. 1 Publication2
Alternative sequenceiVSP_0285841M → MNSVLTKHGSPPRSWLSLCS GT in isoform 2. 1 Publication1
Alternative sequenceiVSP_036987969 – 986GIRTQ…SWDCR → AQEADPGPALPNQDHPAA in isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_036988987 – 1062Missing in isoform 4. 1 PublicationAdd BLAST76

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018263 mRNA Translation: BAA34440.2 Different initiation.
AK096347 mRNA Translation: BAG53269.1
AK294875 mRNA Translation: BAH11909.1
AK299523 mRNA Translation: BAH13058.1
AL591866 Genomic DNA No translation available.
AL158217 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71539.1
CH471130 Genomic DNA Translation: EAW71547.1
BC015231 mRNA Translation: AAH15231.1
BC042606 mRNA No translation available.
AB097001 mRNA Translation: BAC77354.1 Sequence problems.
AK131074 mRNA Translation: BAC85124.1 Sequence problems.
CCDSiCCDS41240.1 [O94827-2]
CCDS41241.1 [O94827-1]
CCDS57967.1 [O94827-4]
CCDS57968.1 [O94827-7]
CCDS57969.1 [O94827-6]
CCDS79.1 [O94827-5]
RefSeqiNP_001036128.1, NM_001042663.1 [O94827-1]
NP_001036129.1, NM_001042664.1 [O94827-5]
NP_001036130.1, NM_001042665.1 [O94827-5]
NP_001252521.1, NM_001265592.1 [O94827-6]
NP_001252522.1, NM_001265593.1 [O94827-7]
NP_001252523.1, NM_001265594.1 [O94827-4]
NP_065682.2, NM_020631.4 [O94827-5]
NP_941374.2, NM_198681.3 [O94827-2]
UniGeneiHs.284232
Hs.462529
Hs.619982

Genome annotation databases

EnsembliENST00000340850; ENSP00000344570; ENSG00000171680 [O94827-5]
ENST00000377725; ENSP00000366954; ENSG00000171680 [O94827-4]
ENST00000377728; ENSP00000366957; ENSG00000171680 [O94827-5]
ENST00000377732; ENSP00000366961; ENSG00000171680 [O94827-3]
ENST00000377748; ENSP00000366977; ENSG00000171680 [O94827-2]
ENST00000400913; ENSP00000383704; ENSG00000171680 [O94827-5]
ENST00000400915; ENSP00000383706; ENSG00000171680 [O94827-1]
ENST00000535355; ENSP00000441445; ENSG00000171680 [O94827-7]
ENST00000537245; ENSP00000439625; ENSG00000171680 [O94827-6]
GeneIDi57449
KEGGihsa:57449
UCSCiuc001ank.1 human [O94827-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB018263 mRNA Translation: BAA34440.2 Different initiation.
AK096347 mRNA Translation: BAG53269.1
AK294875 mRNA Translation: BAH11909.1
AK299523 mRNA Translation: BAH13058.1
AL591866 Genomic DNA No translation available.
AL158217 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71539.1
CH471130 Genomic DNA Translation: EAW71547.1
BC015231 mRNA Translation: AAH15231.1
BC042606 mRNA No translation available.
AB097001 mRNA Translation: BAC77354.1 Sequence problems.
AK131074 mRNA Translation: BAC85124.1 Sequence problems.
CCDSiCCDS41240.1 [O94827-2]
CCDS41241.1 [O94827-1]
CCDS57967.1 [O94827-4]
CCDS57968.1 [O94827-7]
CCDS57969.1 [O94827-6]
CCDS79.1 [O94827-5]
RefSeqiNP_001036128.1, NM_001042663.1 [O94827-1]
NP_001036129.1, NM_001042664.1 [O94827-5]
NP_001036130.1, NM_001042665.1 [O94827-5]
NP_001252521.1, NM_001265592.1 [O94827-6]
NP_001252522.1, NM_001265593.1 [O94827-7]
NP_001252523.1, NM_001265594.1 [O94827-4]
NP_065682.2, NM_020631.4 [O94827-5]
NP_941374.2, NM_198681.3 [O94827-2]
UniGeneiHs.284232
Hs.462529
Hs.619982

3D structure databases

ProteinModelPortaliO94827
SMRiO94827
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121522, 16 interactors
IntActiO94827, 3 interactors
STRINGi9606.ENSP00000366977

PTM databases

iPTMnetiO94827
PhosphoSitePlusiO94827

Polymorphism and mutation databases

BioMutaiPLEKHG5

Proteomic databases

EPDiO94827
PaxDbiO94827
PeptideAtlasiO94827
PRIDEiO94827
ProteomicsDBi50469
50470 [O94827-2]
50471 [O94827-3]
50472 [O94827-4]
50473 [O94827-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340850; ENSP00000344570; ENSG00000171680 [O94827-5]
ENST00000377725; ENSP00000366954; ENSG00000171680 [O94827-4]
ENST00000377728; ENSP00000366957; ENSG00000171680 [O94827-5]
ENST00000377732; ENSP00000366961; ENSG00000171680 [O94827-3]
ENST00000377748; ENSP00000366977; ENSG00000171680 [O94827-2]
ENST00000400913; ENSP00000383704; ENSG00000171680 [O94827-5]
ENST00000400915; ENSP00000383706; ENSG00000171680 [O94827-1]
ENST00000535355; ENSP00000441445; ENSG00000171680 [O94827-7]
ENST00000537245; ENSP00000439625; ENSG00000171680 [O94827-6]
GeneIDi57449
KEGGihsa:57449
UCSCiuc001ank.1 human [O94827-1]

Organism-specific databases

CTDi57449
DisGeNETi57449
EuPathDBiHostDB:ENSG00000171680.20
GeneCardsiPLEKHG5
HGNCiHGNC:29105 PLEKHG5
HPAiHPA049570
MalaCardsiPLEKHG5
MIMi611067 phenotype
611101 gene
615376 phenotype
neXtProtiNX_O94827
OpenTargetsiENSG00000171680
Orphaneti369867 Autosomal recessive intermediate Charcot-Marie-Tooth disease type C
206580 Autosomal recessive lower motor neuron disease with childhood onset
PharmGKBiPA142671164
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3521 Eukaryota
ENOG410XRPT LUCA
GeneTreeiENSGT00510000046843
HOGENOMiHOG000049145
HOVERGENiHBG058106
InParanoidiO94827
KOiK19464
OMAiGISAQHR
OrthoDBiEOG091G00RK
PhylomeDBiO94827
TreeFamiTF316755

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

GeneWikiiPLEKHG5
GenomeRNAii57449
PROiPR:O94827
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171680 Expressed in 123 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_PLEKHG5
ExpressionAtlasiO94827 baseline and differential
GenevisibleiO94827 HS

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPKHG5_HUMAN
AccessioniPrimary (citable) accession number: O94827
Secondary accession number(s): B3KU07
, B7Z2M3, B7Z5X2, F5GZ21, F5H1I0, Q5SY17, Q5T8W5, Q5T8W9, Q6ZNM0, Q7Z436, Q86YD8, Q96BS1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: November 7, 2018
This is version 150 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again