Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Retinal dehydrogenase 2

Gene

ALDH1A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently (By similarity).By similarity

Catalytic activityi

Retinal + NAD+ + H2O = retinoate + NADH.

Pathwayi: retinol metabolism

This protein is involved in the pathway retinol metabolism, which is part of Cofactor metabolism.
View all proteins of this organism that are known to be involved in the pathway retinol metabolism and in Cofactor metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei187Transition state stabilizerBy similarity1
Active sitei286Proton acceptorPROSITE-ProRule annotation1
Active sitei320NucleophilePROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi263 – 268NADBy similarity6

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
LigandNAD

Enzyme and pathway databases

BioCyciMetaCyc:HS05232-MONOMER
ReactomeiR-HSA-5365859 RA biosynthesis pathway
UniPathwayi
UPA00912

Names & Taxonomyi

Protein namesi
Recommended name:
Retinal dehydrogenase 2 (EC:1.2.1.36)
Short name:
RALDH 2
Short name:
RalDH2
Alternative name(s):
Aldehyde dehydrogenase family 1 member A2
Retinaldehyde-specific dehydrogenase type 2
Short name:
RALDH(II)
Gene namesi
Name:ALDH1A2
Synonyms:RALDH2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000128918.14
HGNCiHGNC:15472 ALDH1A2
MIMi603687 gene
neXtProtiNX_O94788

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi8854
OpenTargetsiENSG00000128918
PharmGKBiPA24693

Chemistry databases

ChEMBLiCHEMBL3112384
DrugBankiDB00157 NADH
DB00755 Tretinoin
DB00162 Vitamin A

Polymorphism and mutation databases

BioMutaiALDH1A2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000564221 – 518Retinal dehydrogenase 2Add BLAST518

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei168PhosphotyrosineCombined sources1
Modified residuei351PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO94788
MaxQBiO94788
PaxDbiO94788
PeptideAtlasiO94788
PRIDEiO94788
ProteomicsDBi50442
50443 [O94788-2]

PTM databases

iPTMnetiO94788
PhosphoSitePlusiO94788

Expressioni

Gene expression databases

BgeeiENSG00000128918 Expressed in 168 organ(s), highest expression level in adrenal tissue
CleanExiHS_ALDH1A2
ExpressionAtlasiO94788 baseline and differential
GenevisibleiO94788 HS

Organism-specific databases

HPAiHPA010022

Interactioni

Subunit structurei

Homotetramer.By similarity

Protein-protein interaction databases

BioGridi114379, 5 interactors
IntActiO94788, 3 interactors
STRINGi9606.ENSP00000249750

Chemistry databases

BindingDBiO94788

Structurei

Secondary structure

1518
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO94788
SMRiO94788
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the aldehyde dehydrogenase family.Curated

Phylogenomic databases

eggNOGiKOG2450 Eukaryota
COG1012 LUCA
GeneTreeiENSGT00760000118999
HOGENOMiHOG000271505
HOVERGENiHBG000097
InParanoidiO94788
KOiK07249
OMAiRHVMIKH
OrthoDBiEOG091G05E8
PhylomeDBiO94788
TreeFamiTF300455

Family and domain databases

Gene3Di3.40.309.10, 1 hit
3.40.605.10, 2 hits
InterProiView protein in InterPro
IPR016161 Ald_DH/histidinol_DH
IPR016163 Ald_DH_C
IPR016160 Ald_DH_CS_CYS
IPR029510 Ald_DH_CS_GLU
IPR016162 Ald_DH_N
IPR015590 Aldehyde_DH_dom
PfamiView protein in Pfam
PF00171 Aldedh, 1 hit
SUPFAMiSSF53720 SSF53720, 1 hit
PROSITEiView protein in PROSITE
PS00070 ALDEHYDE_DEHYDR_CYS, 1 hit
PS00687 ALDEHYDE_DEHYDR_GLU, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: O94788-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSSKIEMPG EVKADPAALM ASLHLLPSPT PNLEIKYTKI FINNEWQNSE
60 70 80 90 100
SGRVFPVYNP ATGEQVCEVQ EADKADIDKA VQAARLAFSL GSVWRRMDAS
110 120 130 140 150
ERGRLLDKLA DLVERDRAVL ATMESLNGGK PFLQAFYVDL QGVIKTFRYY
160 170 180 190 200
AGWADKIHGM TIPVDGDYFT FTRHEPIGVC GQIIPWNFPL LMFAWKIAPA
210 220 230 240 250
LCCGNTVVIK PAEQTPLSAL YMGALIKEAG FPPGVINILP GYGPTAGAAI
260 270 280 290 300
ASHIGIDKIA FTGSTEVGKL IQEAAGRSNL KRVTLELGGK SPNIIFADAD
310 320 330 340 350
LDYAVEQAHQ GVFFNQGQCC TAGSRIFVEE SIYEEFVRRS VERAKRRVVG
360 370 380 390 400
SPFDPTTEQG PQIDKKQYNK ILELIQSGVA EGAKLECGGK GLGRKGFFIE
410 420 430 440 450
PTVFSNVTDD MRIAKEEIFG PVQEILRFKT MDEVIERANN SDFGLVAAVF
460 470 480 490 500
TNDINKALTV SSAMQAGTVW INCYNALNAQ SPFGGFKMSG NGREMGEFGL
510
REYSEVKTVT VKIPQKNS
Length:518
Mass (Da):56,724
Last modified:March 7, 2006 - v3
Checksum:iAAEE7A886951373F
GO
Isoform 2 (identifier: O94788-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-266: Missing.

Note: No experimental confirmation available.
Show »
Length:480
Mass (Da):53,060
Checksum:i5AC931BE5ED26AA4
GO
Isoform 3 (identifier: O94788-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTK → MKNQCETVWLKSPIKLKL

Note: No experimental confirmation available.
Show »
Length:497
Mass (Da):54,673
Checksum:i27E8A8307A680BB7
GO
Isoform 4 (identifier: O94788-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:422
Mass (Da):46,137
Checksum:i4927D07BDD3BAC5D
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMG7H0YMG7_HUMAN
Retinal dehydrogenase 2
ALDH1A2
489Annotation score:
H0YKL3H0YKL3_HUMAN
Retinal dehydrogenase 2
ALDH1A2
85Annotation score:
Q9UED3Q9UED3_HUMAN
RALDH2-T
ALDH1A2 RALDH2
25Annotation score:
E9PF31E9PF31_HUMAN
Retinal dehydrogenase 2
ALDH1A2
40Annotation score:
H0YMT5H0YMT5_HUMAN
Retinal dehydrogenase 2
ALDH1A2
24Annotation score:
A0A0G2JL97A0A0G2JL97_HUMAN
Retinal dehydrogenase 2
ALDH1A2
9Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti231F → L in BAG64174 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02543950E → G1 PublicationCorresponds to variant dbSNP:rs34266719Ensembl.1
Natural variantiVAR_025440110A → V1 PublicationCorresponds to variant dbSNP:rs35365164Ensembl.1
Natural variantiVAR_025441348V → I4 PublicationsCorresponds to variant dbSNP:rs4646626Ensembl.1
Natural variantiVAR_025442436E → K1 PublicationCorresponds to variant dbSNP:rs34744827Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472591 – 96Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0444961 – 39MTSSK…IKYTK → MKNQCETVWLKSPIKLKL in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_017363229 – 266Missing in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015226 mRNA Translation: BAA34785.1
AB015227 mRNA Translation: BAA34786.1
AB015228 mRNA Translation: BAA34787.1
AK128709 mRNA Translation: BAG54714.1
AK303057 mRNA Translation: BAG64174.1
DQ322171 Genomic DNA Translation: ABC40749.1
AC012653 Genomic DNA No translation available.
AC018904 Genomic DNA No translation available.
AC025431 Genomic DNA No translation available.
AC066616 Genomic DNA No translation available.
AC084781 Genomic DNA No translation available.
BC030589 mRNA Translation: AAH30589.1
AL110299 mRNA Translation: CAB53740.2
CCDSiCCDS10163.1 [O94788-1]
CCDS10164.1 [O94788-2]
CCDS45266.1 [O94788-4]
CCDS55968.1 [O94788-3]
PIRiT14799
RefSeqiNP_001193826.1, NM_001206897.1 [O94788-3]
NP_003879.2, NM_003888.3 [O94788-1]
NP_733797.1, NM_170696.2 [O94788-2]
NP_733798.1, NM_170697.2 [O94788-4]
UniGeneiHs.643455

Genome annotation databases

EnsembliENST00000249750; ENSP00000249750; ENSG00000128918 [O94788-1]
ENST00000347587; ENSP00000309623; ENSG00000128918 [O94788-2]
ENST00000537372; ENSP00000438296; ENSG00000128918 [O94788-3]
ENST00000559517; ENSP00000453408; ENSG00000128918 [O94788-4]
GeneIDi8854
KEGGihsa:8854
UCSCiuc002aew.4 human [O94788-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015226 mRNA Translation: BAA34785.1
AB015227 mRNA Translation: BAA34786.1
AB015228 mRNA Translation: BAA34787.1
AK128709 mRNA Translation: BAG54714.1
AK303057 mRNA Translation: BAG64174.1
DQ322171 Genomic DNA Translation: ABC40749.1
AC012653 Genomic DNA No translation available.
AC018904 Genomic DNA No translation available.
AC025431 Genomic DNA No translation available.
AC066616 Genomic DNA No translation available.
AC084781 Genomic DNA No translation available.
BC030589 mRNA Translation: AAH30589.1
AL110299 mRNA Translation: CAB53740.2
CCDSiCCDS10163.1 [O94788-1]
CCDS10164.1 [O94788-2]
CCDS45266.1 [O94788-4]
CCDS55968.1 [O94788-3]
PIRiT14799
RefSeqiNP_001193826.1, NM_001206897.1 [O94788-3]
NP_003879.2, NM_003888.3 [O94788-1]
NP_733797.1, NM_170696.2 [O94788-2]
NP_733798.1, NM_170697.2 [O94788-4]
UniGeneiHs.643455

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4X2QX-ray2.94A/B/C/D21-518[»]
6ALJX-ray1.89A/B/C/D26-518[»]
6B5GX-ray2.20A/B/C/D26-518[»]
6B5HX-ray2.30A/B/C/D26-518[»]
6B5IX-ray2.60A/B/C/D26-518[»]
ProteinModelPortaliO94788
SMRiO94788
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114379, 5 interactors
IntActiO94788, 3 interactors
STRINGi9606.ENSP00000249750

Chemistry databases

BindingDBiO94788
ChEMBLiCHEMBL3112384
DrugBankiDB00157 NADH
DB00755 Tretinoin
DB00162 Vitamin A

PTM databases

iPTMnetiO94788
PhosphoSitePlusiO94788

Polymorphism and mutation databases

BioMutaiALDH1A2

Proteomic databases

EPDiO94788
MaxQBiO94788
PaxDbiO94788
PeptideAtlasiO94788
PRIDEiO94788
ProteomicsDBi50442
50443 [O94788-2]

Protocols and materials databases

DNASUi8854
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000249750; ENSP00000249750; ENSG00000128918 [O94788-1]
ENST00000347587; ENSP00000309623; ENSG00000128918 [O94788-2]
ENST00000537372; ENSP00000438296; ENSG00000128918 [O94788-3]
ENST00000559517; ENSP00000453408; ENSG00000128918 [O94788-4]
GeneIDi8854
KEGGihsa:8854
UCSCiuc002aew.4 human [O94788-1]

Organism-specific databases

CTDi8854
DisGeNETi8854
EuPathDBiHostDB:ENSG00000128918.14
GeneCardsiALDH1A2
H-InvDBiHIX0038341
HGNCiHGNC:15472 ALDH1A2
HPAiHPA010022
MIMi603687 gene
neXtProtiNX_O94788
OpenTargetsiENSG00000128918
PharmGKBiPA24693
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2450 Eukaryota
COG1012 LUCA
GeneTreeiENSGT00760000118999
HOGENOMiHOG000271505
HOVERGENiHBG000097
InParanoidiO94788
KOiK07249
OMAiRHVMIKH
OrthoDBiEOG091G05E8
PhylomeDBiO94788
TreeFamiTF300455

Enzyme and pathway databases

UniPathwayi
UPA00912

BioCyciMetaCyc:HS05232-MONOMER
ReactomeiR-HSA-5365859 RA biosynthesis pathway

Miscellaneous databases

ChiTaRSiALDH1A2 human
GeneWikiiALDH1A2
GenomeRNAii8854
PROiPR:O94788
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000128918 Expressed in 168 organ(s), highest expression level in adrenal tissue
CleanExiHS_ALDH1A2
ExpressionAtlasiO94788 baseline and differential
GenevisibleiO94788 HS

Family and domain databases

Gene3Di3.40.309.10, 1 hit
3.40.605.10, 2 hits
InterProiView protein in InterPro
IPR016161 Ald_DH/histidinol_DH
IPR016163 Ald_DH_C
IPR016160 Ald_DH_CS_CYS
IPR029510 Ald_DH_CS_GLU
IPR016162 Ald_DH_N
IPR015590 Aldehyde_DH_dom
PfamiView protein in Pfam
PF00171 Aldedh, 1 hit
SUPFAMiSSF53720 SSF53720, 1 hit
PROSITEiView protein in PROSITE
PS00070 ALDEHYDE_DEHYDR_CYS, 1 hit
PS00687 ALDEHYDE_DEHYDR_GLU, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAL1A2_HUMAN
AccessioniPrimary (citable) accession number: O94788
Secondary accession number(s): B3KY52
, B4DZR2, F5H2Y9, H0YM00, Q2PJS6, Q8NHQ4, Q9UBR8, Q9UFY0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: March 7, 2006
Last modified: September 12, 2018
This is version 169 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again