Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O94788 (AL1A2_HUMAN)

Entry version 189 (29 Sep 2021)
Sequence version 3 (07 Mar 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Retinal dehydrogenase 2

Gene

ALDH1A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts retinaldehyde to retinoic acid (PubMed:29240402).

Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Can metabolize octanal and decanal, but has only very low activity with benzaldehyde, acetaldehyde and propanal. Displays complete lack of activity with citral (By similarity).

By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: retinol metabolism

This protein is involved in the pathway retinol metabolism, which is part of Cofactor metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway retinol metabolism and in Cofactor metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei187Transition state stabilizerBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei286Proton acceptorPROSITE-ProRule annotation1
Active sitei320NucleophilePROSITE-ProRule annotation1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei417NADCombined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi184 – 186NADCombined sources1 Publication3
Nucleotide bindingi210 – 213NADCombined sources1 Publication4
Nucleotide bindingi264 – 266NADCombined sources1 Publication3
Nucleotide bindingi366 – 370NADCombined sources1 Publication5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processLipid metabolism
LigandNAD

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS05232-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		1.2.1.36, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O94788

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5365859, RA biosynthesis pathway

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00912

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Retinal dehydrogenase 2 (EC:1.2.1.361 Publication)
Short name:
RALDH 2
Short name:
RalDH21 Publication
Alternative name(s):
Aldehyde dehydrogenase family 1 member A2
Retinaldehyde-specific dehydrogenase type 2
Short name:
RALDH(II)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ALDH1A2
Synonyms:RALDH2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:15472, ALDH1A2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603687, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O94788

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000128918

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8854

Open Targets

More...OpenTargetsi		ENSG00000128918

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24693

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O94788, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3112384

Drug and drug target database

More...DrugBanki		DB00157, NADH
DB00755, Tretinoin
DB00162, Vitamin A

DrugCentral

More...DrugCentrali		O94788

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ALDH1A2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000564221 – 518Retinal dehydrogenase 2Add BLAST518

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei168PhosphotyrosineCombined sources1
Modified residuei351PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O94788

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O94788

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O94788

MaxQB - The MaxQuant DataBase

More...MaxQBi		O94788

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O94788

PeptideAtlas

More...PeptideAtlasi		O94788

PRoteomics IDEntifications database

More...PRIDEi		O94788

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		26115
40109
50442 [O94788-1]
50443 [O94788-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O94788

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O94788

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000128918, Expressed in adrenal tissue and 189 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O94788, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O94788, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000128918, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114379, 12 interactors

Protein interaction database and analysis system

More...IntActi		O94788, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000249750

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O94788

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O94788, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1518
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O94788

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the aldehyde dehydrogenase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2450, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158898

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005391_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O94788

Identification of Orthologs from Complete Genome Data

More...OMAi		ERWSPAC

Database of Orthologous Groups

More...OrthoDBi		153834at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O94788

TreeFam database of animal gene trees

More...TreeFami		TF300455

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.309.10, 1 hit
3.40.605.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR016161, Ald_DH/histidinol_DH
IPR016163, Ald_DH_C
IPR016160, Ald_DH_CS_CYS
IPR029510, Ald_DH_CS_GLU
IPR016162, Ald_DH_N
IPR015590, Aldehyde_DH_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00171, Aldedh, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53720, SSF53720, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00070, ALDEHYDE_DEHYDR_CYS, 1 hit
PS00687, ALDEHYDE_DEHYDR_GLU, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94788-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSSKIEMPG EVKADPAALM ASLHLLPSPT PNLEIKYTKI FINNEWQNSE 
        60         70         80         90        100
SGRVFPVYNP ATGEQVCEVQ EADKADIDKA VQAARLAFSL GSVWRRMDAS 
       110        120        130        140        150
ERGRLLDKLA DLVERDRAVL ATMESLNGGK PFLQAFYVDL QGVIKTFRYY 
       160        170        180        190        200
AGWADKIHGM TIPVDGDYFT FTRHEPIGVC GQIIPWNFPL LMFAWKIAPA 
       210        220        230        240        250
LCCGNTVVIK PAEQTPLSAL YMGALIKEAG FPPGVINILP GYGPTAGAAI 
       260        270        280        290        300
ASHIGIDKIA FTGSTEVGKL IQEAAGRSNL KRVTLELGGK SPNIIFADAD 
       310        320        330        340        350
LDYAVEQAHQ GVFFNQGQCC TAGSRIFVEE SIYEEFVRRS VERAKRRVVG 
       360        370        380        390        400
SPFDPTTEQG PQIDKKQYNK ILELIQSGVA EGAKLECGGK GLGRKGFFIE 
       410        420        430        440        450
PTVFSNVTDD MRIAKEEIFG PVQEILRFKT MDEVIERANN SDFGLVAAVF 
       460        470        480        490        500
TNDINKALTV SSAMQAGTVW INCYNALNAQ SPFGGFKMSG NGREMGEFGL 
       510 
REYSEVKTVT VKIPQKNS
Length:518
Mass (Da):56,724
Last modified:March 7, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAAEE7A886951373F
GO
Isoform 2 (identifier: O94788-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-266: Missing.

Show »
Length:480
Mass (Da):53,060
Checksum:i5AC931BE5ED26AA4
GO
Isoform 3 (identifier: O94788-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTK → MKNQCETVWLKSPIKLKL

Show »
Length:497
Mass (Da):54,673
Checksum:i27E8A8307A680BB7
GO
Isoform 4 (identifier: O94788-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:422
Mass (Da):46,137
Checksum:i4927D07BDD3BAC5D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMG7H0YMG7_HUMAN
Retinal dehydrogenase 2
ALDH1A2
489Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKL3H0YKL3_HUMAN
Retinal dehydrogenase 2
ALDH1A2
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9UED3Q9UED3_HUMAN
RALDH2-T
ALDH1A2 RALDH2
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PF31E9PF31_HUMAN
Retinal dehydrogenase 2
ALDH1A2
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YMT5H0YMT5_HUMAN
Retinal dehydrogenase 2
ALDH1A2
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JL97A0A0G2JL97_HUMAN
Retinal dehydrogenase 2
ALDH1A2
9Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti231F → L in BAG64174 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02543950E → G1 PublicationCorresponds to variant dbSNP:rs34266719Ensembl.1
Natural variantiVAR_025440110A → V1 PublicationCorresponds to variant dbSNP:rs35365164Ensembl.1
Natural variantiVAR_025441348V → I4 PublicationsCorresponds to variant dbSNP:rs4646626Ensembl.1
Natural variantiVAR_025442436E → K1 PublicationCorresponds to variant dbSNP:rs34744827Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0472591 – 96Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0444961 – 39MTSSK…IKYTK → MKNQCETVWLKSPIKLKL in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_017363229 – 266Missing in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB015226 mRNA Translation: BAA34785.1
AB015227 mRNA Translation: BAA34786.1
AB015228 mRNA Translation: BAA34787.1
AK128709 mRNA Translation: BAG54714.1
AK303057 mRNA Translation: BAG64174.1
DQ322171 Genomic DNA Translation: ABC40749.1
AC012653 Genomic DNA No translation available.
AC018904 Genomic DNA No translation available.
AC025431 Genomic DNA No translation available.
AC066616 Genomic DNA No translation available.
AC084781 Genomic DNA No translation available.
BC030589 mRNA Translation: AAH30589.1
AL110299 mRNA Translation: CAB53740.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10163.1 [O94788-1]
CCDS10164.1 [O94788-2]
CCDS45266.1 [O94788-4]
CCDS55968.1 [O94788-3]

Protein sequence database of the Protein Information Resource

More...PIRi		T14799

NCBI Reference Sequences

More...RefSeqi		NP_001193826.1, NM_001206897.1 [O94788-3]
NP_003879.2, NM_003888.3 [O94788-1]
NP_733797.1, NM_170696.2 [O94788-2]
NP_733798.1, NM_170697.2 [O94788-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000249750; ENSP00000249750; ENSG00000128918 [O94788-1]
ENST00000347587; ENSP00000309623; ENSG00000128918 [O94788-2]
ENST00000537372; ENSP00000438296; ENSG00000128918 [O94788-3]
ENST00000559517; ENSP00000453408; ENSG00000128918 [O94788-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8854

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8854

UCSC genome browser

More...UCSCi		uc002aew.4, human [O94788-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015226 mRNA Translation: BAA34785.1
AB015227 mRNA Translation: BAA34786.1
AB015228 mRNA Translation: BAA34787.1
AK128709 mRNA Translation: BAG54714.1
AK303057 mRNA Translation: BAG64174.1
DQ322171 Genomic DNA Translation: ABC40749.1
AC012653 Genomic DNA No translation available.
AC018904 Genomic DNA No translation available.
AC025431 Genomic DNA No translation available.
AC066616 Genomic DNA No translation available.
AC084781 Genomic DNA No translation available.
BC030589 mRNA Translation: AAH30589.1
AL110299 mRNA Translation: CAB53740.2
CCDSiCCDS10163.1 [O94788-1]
CCDS10164.1 [O94788-2]
CCDS45266.1 [O94788-4]
CCDS55968.1 [O94788-3]
PIRiT14799
RefSeqiNP_001193826.1, NM_001206897.1 [O94788-3]
NP_003879.2, NM_003888.3 [O94788-1]
NP_733797.1, NM_170696.2 [O94788-2]
NP_733798.1, NM_170697.2 [O94788-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4X2QX-ray2.94A/B/C/D21-518[»]
6ALJX-ray1.89A/B/C/D26-518[»]
6B5GX-ray2.20A/B/C/D26-518[»]
6B5HX-ray2.30A/B/C/D26-518[»]
6B5IX-ray2.60A/B/C/D26-518[»]
SMRiO94788
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114379, 12 interactors
IntActiO94788, 6 interactors
STRINGi9606.ENSP00000249750

Chemistry databases

BindingDBiO94788
ChEMBLiCHEMBL3112384
DrugBankiDB00157, NADH
DB00755, Tretinoin
DB00162, Vitamin A
DrugCentraliO94788

PTM databases

iPTMnetiO94788
PhosphoSitePlusiO94788

Genetic variation databases

BioMutaiALDH1A2

Proteomic databases

EPDiO94788
jPOSTiO94788
MassIVEiO94788
MaxQBiO94788
PaxDbiO94788
PeptideAtlasiO94788
PRIDEiO94788
ProteomicsDBi26115
40109
50442 [O94788-1]
50443 [O94788-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2127, 370 antibodies

The DNASU plasmid repository

More...DNASUi		8854

Genome annotation databases

EnsembliENST00000249750; ENSP00000249750; ENSG00000128918 [O94788-1]
ENST00000347587; ENSP00000309623; ENSG00000128918 [O94788-2]
ENST00000537372; ENSP00000438296; ENSG00000128918 [O94788-3]
ENST00000559517; ENSP00000453408; ENSG00000128918 [O94788-4]
GeneIDi8854
KEGGihsa:8854
UCSCiuc002aew.4, human [O94788-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8854
DisGeNETi8854

GeneCards: human genes, protein and diseases

More...GeneCardsi		ALDH1A2
HGNCiHGNC:15472, ALDH1A2
HPAiENSG00000128918, Low tissue specificity
MIMi603687, gene
neXtProtiNX_O94788
OpenTargetsiENSG00000128918
PharmGKBiPA24693
VEuPathDBiHostDB:ENSG00000128918

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2450, Eukaryota
GeneTreeiENSGT00940000158898
HOGENOMiCLU_005391_0_0_1
InParanoidiO94788
OMAiERWSPAC
OrthoDBi153834at2759
PhylomeDBiO94788
TreeFamiTF300455

Enzyme and pathway databases

UniPathwayiUPA00912
BioCyciMetaCyc:HS05232-MONOMER
BRENDAi1.2.1.36, 2681
PathwayCommonsiO94788
ReactomeiR-HSA-5365859, RA biosynthesis pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8854, 3 hits in 1021 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ALDH1A2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ALDH1A2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8854
PharosiO94788, Tbio

Protein Ontology

More...PROi		PR:O94788
RNActiO94788, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000128918, Expressed in adrenal tissue and 189 other tissues
ExpressionAtlasiO94788, baseline and differential
GenevisibleiO94788, HS

Family and domain databases

Gene3Di3.40.309.10, 1 hit
3.40.605.10, 1 hit
InterProiView protein in InterPro
IPR016161, Ald_DH/histidinol_DH
IPR016163, Ald_DH_C
IPR016160, Ald_DH_CS_CYS
IPR029510, Ald_DH_CS_GLU
IPR016162, Ald_DH_N
IPR015590, Aldehyde_DH_dom
PfamiView protein in Pfam
PF00171, Aldedh, 1 hit
SUPFAMiSSF53720, SSF53720, 1 hit
PROSITEiView protein in PROSITE
PS00070, ALDEHYDE_DEHYDR_CYS, 1 hit
PS00687, ALDEHYDE_DEHYDR_GLU, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAL1A2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94788
Secondary accession number(s): B3KY52
, B4DZR2, F5H2Y9, H0YM00, Q2PJS6, Q8NHQ4, Q9UBR8, Q9UFY0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: March 7, 2006
Last modified: September 29, 2021
This is version 189 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again