Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Unconventional prefoldin RPB5 interactor 1

Gene

URI1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to inhibit anchorage-independent growth in prostate cancer cells. Required for cell survival in ovarian cancer cells. Together with UXT, associates with chromatin to the NKX3-1 promoter region. Antagonizes transcriptional modulation via hepatitis B virus X protein.
Plays a central role in maintaining S6K1 signaling and BAD phosphorylation under normal growth conditions thereby protecting cells from potential deleterious effects of sustained S6K1 signaling. The URI1-PPP1CC complex acts as a central component of a negative feedback mechanism that counteracts excessive S6K1 survival signaling to BAD in response to growth factors. Mediates inhibition of PPP1CC phosphatase activity in mitochondria. Coordinates the regulation of nutrient-sensitive gene expression availability in a mTOR-dependent manner. Seems to be a scaffolding protein able to assemble a prefoldin-like complex that contains PFDs and proteins with roles in transcription and ubiquitination.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • chromatin binding Source: UniProtKB
  • phosphatase inhibitor activity Source: GO_Central
  • phosphoprotein binding Source: UniProtKB
  • protein phosphatase inhibitor activity Source: UniProtKB-KW
  • RNA polymerase II complex binding Source: UniProtKB
  • transcription corepressor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtein phosphatase inhibitor, Repressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Unconventional prefoldin RPB5 interactor 1
Alternative name(s):
Protein NNX3
Protein phosphatase 1 regulatory subunit 19
RNA polymerase II subunit 5-mediating protein
Short name:
RPB5-mediating protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:URI1
Synonyms:C19orf2, NNX3, PPP1R19, RMP, URI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000105176.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13236 URI1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603494 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O94763

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi372S → A: Does not lead to dissociation of the URI1-PPP1CC complex. Enhances phosphorylation of RPS6KB1 after IGF1 stimulation. Confers a cell survival increase. 2 Publications1

Keywords - Diseasei

Oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
8725

Open Targets

More...
OpenTargetsi
ENSG00000105176

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134962614

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
URI1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000973651 – 535Unconventional prefoldin RPB5 interactor 1Add BLAST535

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei372Phosphoserine; by RPS6KB1Combined sources2 Publications1
Modified residuei373PhosphothreonineCombined sources1
Modified residuei442PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation occurs essentially on serine residues. Phosphorylation occurs in response to androgen treatment in prostate cancer cells in a mTOR-dependent manner. Phosphorylated; hyperhosphorylated in mitochondria in a mTORC-dependent signaling pathway. Phosphorylated at Ser-372 by RPS6KB1 in a growth factor- and rapamycin-dependent manner. S6K1-mediated mitochondrial phosphorylation at Ser-372 disrupts the URI1-PPP1CC complex in the mitochondrion, relieves PPP1CC phosphatase inhibition activity and hence engages a negative feedback diminishing RPS6KB1 kinase activity, preventing sustained S6K1-dependent signaling.4 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O94763

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O94763

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O94763

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O94763

PeptideAtlas

More...
PeptideAtlasi
O94763

PRoteomics IDEntifications database

More...
PRIDEi
O94763

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50428
50429 [O94763-2]
50430 [O94763-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O94763

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O94763

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O94763

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Expressed in ovarian cancers (at protein level). Expressed strongly in skeletal muscle. Expressed weakly in brain, heart, pancreas and in prostate epithelial cells.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000105176 Expressed in 226 organ(s), highest expression level in adrenal tissue

CleanEx database of gene expression profiles

More...
CleanExi
HS_C19orf2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O94763 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O94763 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA071709

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Component of the URI complex that contains PFDN2, POLR2E/RPB5, RUVBL2, RUVBL1 and URI1. Interacts with PPP1CC; the interaction is phosphorylation-dependent and occurs in a growth factor-dependent manner. Interacts with PFDN2, PFDN4 and STAP1; the interactions are phosphorylation-dependent and occur in a growth-dependent manner in the mitochondrion. Interacts (via the middle C-terminal region) with GTF2F1 and GTF2F2. Interacts with DMAP1, POLR2E/RPB5 and UXT.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114264, 84 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O94763

Protein interaction database and analysis system

More...
IntActi
O94763, 52 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000442436

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O94763

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O94763

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi299 – 311Poly-AspAdd BLAST13
Compositional biasi314 – 321Poly-Asp8

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3130 Eukaryota
ENOG41101NF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002362

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154150

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007610

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O94763

KEGG Orthology (KO)

More...
KOi
K17560

Identification of Orthologs from Complete Genome Data

More...
OMAi
VMHQVTD

Database of Orthologous Groups

More...
OrthoDBi
964566at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O94763

TreeFam database of animal gene trees

More...
TreeFami
TF332816

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.370, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009053 Prefoldin
IPR004127 Prefoldin_subunit_alpha

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02996 Prefoldin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O94763-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAPTVETPP DPSPPSAPAP ALVPLRAPDV ARLREEQEKV VTNCQERIQH
60 70 80 90 100
WKKVDNDYNA LRERLSTLPD KLSYNIMVPF GPFAFMPGKL VHTNEVTVLL
110 120 130 140 150
GDNWFAKCSA KQAVGLVEHR KEHVRKTIDD LKKVMKNFES RVEFTEDLQK
160 170 180 190 200
MSDAAGDIVD IREEIKCDFE FKAKHRIAHK PHSKPKTSDI FEADIANDVK
210 220 230 240 250
SKDLLADKEL WARLEELERQ EELLGELDSK PDTVIANGED TTSSEEEKED
260 270 280 290 300
RNTNVNAMHQ VTDSHTPCHK DVASSEPFSG QVNSQLNCSV NGSSSYHSDD
310 320 330 340 350
DDDDDDDDDD DNIDDDDGDN DHEALGVGDN SIPTIYFSHT VEPKRVRINT
360 370 380 390 400
GKNTTLKFSE KKEEAKRKRK NSTGSGHSAQ ELPTIRTPAD IYRAFVDVVN
410 420 430 440 450
GEYVPRKSIL KSRSRENSVC SDTSESSAAE FDDRRGVLRS ISCEEATCSD
460 470 480 490 500
TSESILEEEP QENQKKLLPL SVTPEAFSGT VIEKEFVSPS LTPPPAIAHP
510 520 530
ALPTIPERKE VLLEASEETG KRVSKFKAAR LQQKD
Length:535
Mass (Da):59,832
Last modified:June 16, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDBB046A392E3C752
GO
Isoform 2 (identifier: O94763-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: Missing.

Show »
Length:459
Mass (Da):51,247
Checksum:i5EF69C27FEB5EAFE
GO
Isoform 3 (identifier: O94763-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MEAPTVETPP...TNCQERIQHW → MRLGNVDFTLGSNVPCVYLVFSVNR

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):56,978
Checksum:i5BA8E178FAE37863
GO
Isoform 4 (identifier: O94763-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEK → MTTWSSLQGSHVSKRALAYAL
     476-535: AFSGTVIEKE...FKAARLQQKD → VLRLVGYSRNLAPLNVIL

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):53,447
Checksum:i2B9B965CD25CE296
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3NI51I3NI51_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L104I3L104_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2V7I3L2V7_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L130I3L130_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L280I3L280_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L467I3L467_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0K5I3L0K5_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQZ9K7EQZ9_HUMAN
Unconventional prefoldin RPB5 inter...
URI1
17Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH26184 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7E → G in BAF84859 (PubMed:14702039).Curated1
Sequence conflicti232D → N in AAH26184 (PubMed:15489334).Curated1
Sequence conflicti311Missing in AAD08679 (PubMed:9878255).Curated1
Sequence conflicti311Missing in BAA34781 (PubMed:9819440).Curated1
Sequence conflicti311Missing in BAF84859 (PubMed:14702039).Curated1
Sequence conflicti311Missing in AAH26184 (PubMed:15489334).Curated1
Sequence conflicti315D → E in BAF84859 (PubMed:14702039).Curated1
Sequence conflicti434R → G in BAA34781 (PubMed:9819440).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05697822L → P. Corresponds to variant dbSNP:rs189187Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0327731 – 76Missing in isoform 2. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_0422591 – 51MEAPT…RIQHW → MRLGNVDFTLGSNVPCVYLV FSVNR in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0447691 – 39MEAPT…EEQEK → MTTWSSLQGSHVSKRALAYA L in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_044770476 – 535AFSGT…LQQKD → VLRLVGYSRNLAPLNVIL in isoform 4. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF091095 mRNA Translation: AAD08679.1
AB006572 mRNA Translation: BAA34781.1
AK292170 mRNA Translation: BAF84859.1
AC008507 mRNA No translation available.
BC026184 mRNA Translation: AAH26184.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12420.1 [O94763-1]
CCDS58658.1 [O94763-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001239570.1, NM_001252641.1 [O94763-4]
NP_003787.2, NM_003796.3 [O94763-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.466391

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360605; ENSP00000353817; ENSG00000105176 [O94763-4]
ENST00000392271; ENSP00000376097; ENSG00000105176 [O94763-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8725

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8725

UCSC genome browser

More...
UCSCi
uc002nsq.4 human [O94763-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF091095 mRNA Translation: AAD08679.1
AB006572 mRNA Translation: BAA34781.1
AK292170 mRNA Translation: BAF84859.1
AC008507 mRNA No translation available.
BC026184 mRNA Translation: AAH26184.2 Different initiation.
CCDSiCCDS12420.1 [O94763-1]
CCDS58658.1 [O94763-4]
RefSeqiNP_001239570.1, NM_001252641.1 [O94763-4]
NP_003787.2, NM_003796.3 [O94763-1]
UniGeneiHs.466391

3D structure databases

ProteinModelPortaliO94763
SMRiO94763
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114264, 84 interactors
CORUMiO94763
IntActiO94763, 52 interactors
STRINGi9606.ENSP00000442436

PTM databases

iPTMnetiO94763
PhosphoSitePlusiO94763
SwissPalmiO94763

Polymorphism and mutation databases

BioMutaiURI1

Proteomic databases

EPDiO94763
jPOSTiO94763
MaxQBiO94763
PaxDbiO94763
PeptideAtlasiO94763
PRIDEiO94763
ProteomicsDBi50428
50429 [O94763-2]
50430 [O94763-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360605; ENSP00000353817; ENSG00000105176 [O94763-4]
ENST00000392271; ENSP00000376097; ENSG00000105176 [O94763-1]
GeneIDi8725
KEGGihsa:8725
UCSCiuc002nsq.4 human [O94763-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8725
DisGeNETi8725
EuPathDBiHostDB:ENSG00000105176.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
URI1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0014980
HGNCiHGNC:13236 URI1
HPAiHPA071709
MIMi603494 gene
neXtProtiNX_O94763
OpenTargetsiENSG00000105176
PharmGKBiPA134962614

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3130 Eukaryota
ENOG41101NF LUCA
GeneTreeiENSGT00390000002362
HOGENOMiHOG000154150
HOVERGENiHBG007610
InParanoidiO94763
KOiK17560
OMAiVMHQVTD
OrthoDBi964566at2759
PhylomeDBiO94763
TreeFamiTF332816

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
URI1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C19orf2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8725

Protein Ontology

More...
PROi
PR:O94763

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000105176 Expressed in 226 organ(s), highest expression level in adrenal tissue
CleanExiHS_C19orf2
ExpressionAtlasiO94763 baseline and differential
GenevisibleiO94763 HS

Family and domain databases

Gene3Di1.10.287.370, 1 hit
InterProiView protein in InterPro
IPR009053 Prefoldin
IPR004127 Prefoldin_subunit_alpha
PfamiView protein in Pfam
PF02996 Prefoldin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRMP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O94763
Secondary accession number(s): A8K805
, H7BY42, Q8TC23, Q9UNU3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: June 16, 2009
Last modified: January 16, 2019
This is version 156 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again