Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (02 Jun 2021)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Pro-neuregulin-1, membrane-bound isoform

Gene

nrg1

Organism
Xenopus laevis (African clawed frog)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Direct ligand for the ERBB tyrosine kinase receptors. Induces expression of acetylcholine receptor in synaptic nuclei.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pro-neuregulin-1, membrane-bound isoform
Short name:
Pro-NRG1
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:nrg1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiXenopus laevis (African clawed frog)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri8355 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiAmphibiaBatrachiaAnuraPipoideaPipidaeXenopodinaeXenopusXenopus

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 260ExtracellularSequence analysisAdd BLAST260
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei261 – 280Helical; Note=Internal signal sequenceSequence analysisAdd BLAST20
Topological domaini281 – 677CytoplasmicSequence analysisAdd BLAST397

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000194701 – 677Pro-neuregulin-1, membrane-bound isoformBy similarityAdd BLAST677
ChainiPRO_00000194711 – 259Neuregulin-1By similarityAdd BLAST259

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi57 ↔ 116By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi124N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi130N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi192 ↔ 206By similarity
Disulfide bondi200 ↔ 220By similarity
Disulfide bondi222 ↔ 231By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform alpha1 is expressed in brain and muscle. Isoform CRD is expressed in brain and spinal cord, but at very low level in muscle.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Strong expression in developing brain and spinal cord of the embryo. Also expressed in the myotomal muscle.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O93383

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 132Ig-like C2-typeAdd BLAST96
Domaini188 – 232EGF-likePROSITE-ProRule annotationAdd BLAST45

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 43DisorderedSequence analysisAdd BLAST43
Regioni78 – 106DisorderedSequence analysisAdd BLAST29
Regioni294 – 326DisorderedSequence analysisAdd BLAST33
Regioni350 – 375DisorderedSequence analysisAdd BLAST26
Regioni397 – 418DisorderedSequence analysisAdd BLAST22
Regioni457 – 479DisorderedSequence analysisAdd BLAST23
Regioni503 – 617DisorderedSequence analysisAdd BLAST115

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi78 – 100Basic and acidic residuesSequence analysisAdd BLAST23
Compositional biasi296 – 319Basic and acidic residuesSequence analysisAdd BLAST24
Compositional biasi351 – 375Polar residuesSequence analysisAdd BLAST25
Compositional biasi503 – 519Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi583 – 597Polar residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neuregulin family.Curated

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

Identification of Orthologs from Complete Genome Data

More...
OMAi
XKSELRI

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000742, EGF-like_dom
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR040180, Neuregulin
IPR002154, Neuregulin_C
IPR018250, NRG1

The PANTHER Classification System

More...
PANTHERi
PTHR11100, PTHR11100, 1 hit
PTHR11100:SF25, PTHR11100:SF25, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679, I-set, 1 hit
PF02158, Neuregulin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01089, NEUREGULIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181, EGF, 1 hit
SM00409, IG, 1 hit
SM00408, IGc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 1 hit
PS50835, IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Isoforms have alpha- or beta-type EGF-like domains.
Isoform Alpha1 (identifier: O93383-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEKKKVKEG KGRKGKGKKD RKGKKAEGSD QGAAASPKLK EIKTQSVQEG
60 70 80 90 100
KKLVLKCQAV SEQPSLKFRW FKGEKEIGAK NKPDSKPEHI KIRGKKKSSE
110 120 130 140 150
LQISKASSAD NGEYKCMVSN QLGNDTVTVN VTIVPKPTYN HLLLMKIYLK
160 170 180 190 200
VTSVEKSVEP STLNLLESQK EVIFATTKRG DTTAGPGHLI KCSDKEKTYC
210 220 230 240 250
VNGGECYVLN GITSSNQFMC KCKPGFTGAR CTETDPLRVV RSEKHLGIEF
260 270 280 290 300
MEAEELYQKR VLTITGICID LLVVGDMCVV DAYCKTKKQR KKLNDRLRQS
310 320 330 340 350
LRERNKNITN KDNRPHNPKN PPPRKNVQLV NQYVSKNVIS SEHVIERETE
360 370 380 390 400
TSFSTSHYTS TTHHSTTVTQ TPSHSWSNGL SESMISEKSY SVIVTSSVEN
410 420 430 440 450
SRHTSPTGPR GRLNGIGGPR DCSYLRHARD TPDSYRDSPH SERYVSAMTT
460 470 480 490 500
PARMSPVEFK TPISPKSPCL ETSPPESSLA VSVPSVAVSP FIEEERPLLL
510 520 530 540 550
VSPPRLREKR YDRKTPQKTP HKQHNSYHHN PGHDSSSLPP NPLRIVEDEE
560 570 580 590 600
YETTQEYEPS LEPAKKLVNS RRQKRTKPNG HISNRLELDS DSSSESSTSE
610 620 630 640 650
SETEDERIGE ETPFLSIQNP LAASLESASL YRHADSRTNP TSRFSTQEEL
660 670
QARLSSIANQ ALCDQKKRKM TCKTLFI
Length:677
Mass (Da):75,795
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49279E8F5BAE396F
GO
Isoform CRD (identifier: O93383-2) [UniParc]FASTAAdd to basket
Also known as: CRD-NRG1, Cysteine-rich domain

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: MAEKKKVKEG...VTVNVTIVPK → MSEDTAEGLQ...KFGTSLLPTE
     223-252: KPGFTGARCTETDPLRVVRSEKHLGIEFME → PNEFTGDRCQNYVMASFYK

Show »
Length:688
Mass (Da):76,968
Checksum:i9D7268A08F5CC89B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0034491 – 136MAEKK…TIVPK → MSEDTAEGLQNQCSEQSSDP PSAELQNEESMPETQDEEET THGITGLAITCCVCLEADRL RICLNSEKICIIPILACLIS LCLCIAGLKWVFVDKIFEYD SPTHLDPGHRGQDLILYTDT APSTLVPSSVRTLPVIIPTT DSKAAVTFKFGTSLLPTE in isoform CRD. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_003450223 – 252KPGFT…IEFME → PNEFTGDRCQNYVMASFYK in isoform CRD. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF076618 mRNA Translation: AAC26804.1
AF142632 mRNA Translation: AAD33893.1

NCBI Reference Sequences

More...
RefSeqi
NP_001079063.1, NM_001085594.1 [O93383-2]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
373595

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
xla:373595

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF076618 mRNA Translation: AAC26804.1
AF142632 mRNA Translation: AAD33893.1
RefSeqiNP_001079063.1, NM_001085594.1 [O93383-2]

3D structure databases

SMRiO93383
ModBaseiSearch...

Genome annotation databases

GeneIDi373595
KEGGixla:373595

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
373595

Phylogenomic databases

OMAiXKSELRI

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR000742, EGF-like_dom
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR040180, Neuregulin
IPR002154, Neuregulin_C
IPR018250, NRG1
PANTHERiPTHR11100, PTHR11100, 1 hit
PTHR11100:SF25, PTHR11100:SF25, 1 hit
PfamiView protein in Pfam
PF07679, I-set, 1 hit
PF02158, Neuregulin, 1 hit
PRINTSiPR01089, NEUREGULIN
SMARTiView protein in SMART
SM00181, EGF, 1 hit
SM00409, IG, 1 hit
SM00408, IGc2, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 1 hit
PS50835, IG_LIKE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRG1_XENLA
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O93383
Secondary accession number(s): Q9W6N0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1998
Last modified: June 2, 2021
This is version 115 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again