Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leukocyte cell-derived chemotaxin-2

Gene

Lect2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi53ZincBy similarity1
Metal bindingi57ZincBy similarity1
Metal bindingi138ZincBy similarity1

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • chemotaxis Source: UniProtKB-KW
  • negative regulation of Wnt signaling pathway Source: MGI

Keywordsi

Biological processChemotaxis
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Leukocyte cell-derived chemotaxin-2
Short name:
LECT-2
Alternative name(s):
Chondromodulin II
Short name:
ChM-II
Gene namesi
Name:Lect2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1278342 Lect2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18By similarityAdd BLAST18
ChainiPRO_000001736519 – 151Leukocyte cell-derived chemotaxin-2Add BLAST133

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi25 ↔ 601 Publication
Disulfide bondi36 ↔ 411 Publication
Disulfide bondi99 ↔ 1421 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiO88803
PaxDbiO88803
PeptideAtlasiO88803
PRIDEiO88803

PTM databases

iPTMnetiO88803
PhosphoSitePlusiO88803

Expressioni

Tissue specificityi

Highly expressed in liver and weakly in testis. Not expressed in heart, brain, spleen, lung, skeletal muscle and kidney.1 Publication

Gene expression databases

CleanExiMM_LECT2

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
itself8EBI-8307190,EBI-8307190

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

MINTiO88803
STRINGi10090.ENSMUSP00000060495

Structurei

3D structure databases

ProteinModelPortaliO88803
SMRiO88803
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the LECT2/MIM-1 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IJ84 Eukaryota
ENOG410XVAU LUCA
HOGENOMiHOG000113312
HOVERGENiHBG052320
InParanoidiO88803
PhylomeDBiO88803
TreeFamiTF331097

Family and domain databases

InterProiView protein in InterPro
IPR008663 LECT2
IPR017381 LECT2_chordata
IPR016047 Peptidase_M23
PANTHERiPTHR11329 PTHR11329, 1 hit
PfamiView protein in Pfam
PF01551 Peptidase_M23, 1 hit
PIRSFiPIRSF038085 LECT3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O88803-1) [UniParc]FASTAAdd to basket
Also known as: LECT2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPTTILISA ALLSSALAGP WANICASKSS NEIRTCDSYG CGQYSAQRTQ
60 70 80 90 100
RHHPGVDVLC SDGSVVYAPF TGKIVGQEKP YRNKNAINDG IRLSGRGFCV
110 120 130 140 150
KIFYIKPIKY KGSIKKGEKL GTLLPLQKIY PGIQSHVHVE NCDSSDPTAY

L
Length:151
Mass (Da):16,405
Last modified:November 1, 1998 - v1
Checksum:i18AF444046B7AE8E
GO
Isoform 2 (identifier: O88803-2) [UniParc]FASTAAdd to basket
Also known as: LECT2Q

The sequence of this isoform differs from the canonical sequence as follows:
     98-151: FCVKIFYIKP...CDSSDPTAYL → QRLQAHTTTLNVFTCYWDKIQIPRPTRFLCQNFLH

Show »
Length:132
Mass (Da):14,586
Checksum:i8676B861E7AF6102
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100V → F in AAH27753 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti129I → V4 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00305198 – 151FCVKI…PTAYL → QRLQAHTTTLNVFTCYWDKI QIPRPTRFLCQNFLH in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009687 mRNA Translation: BAA33383.1
AB009688 mRNA Translation: BAA33384.1
AB009689 Genomic DNA Translation: BAA33385.1
AB009689 Genomic DNA Translation: BAA33386.1
AF035161 mRNA Translation: AAF13302.1
AK131971 mRNA Translation: BAE20911.1
CH466546 Genomic DNA Translation: EDL41242.1
BC027753 mRNA Translation: AAH27753.1
CCDSiCCDS26564.1 [O88803-1]
RefSeqiNP_034832.2, NM_010702.2
UniGeneiMm.16973

Genome annotation databases

GeneIDi16841
KEGGimmu:16841
UCSCiuc007qst.2 mouse [O88803-1]
uc011zad.1 mouse [O88803-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLECT2_MOUSE
AccessioniPrimary (citable) accession number: O88803
Secondary accession number(s): O88804
, Q3V287, Q8K181, Q9QWN3, Q9Z337
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: February 28, 2018
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health