Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (13 Nov 2019)
Sequence version 2 (20 Dec 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kinesin-like protein KIF1B

Gene

Kif1b

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility (By similarity).By similarity
Isoform 1 mediates the transport of synaptic vesicles in neuronal cells.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-RNO-983189 Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kif1b
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Rat genome database

More...
RGDi
621520 Kif1b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254092 – 1816Kinesin-like protein KIF1BAdd BLAST1815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei647PhosphothreonineBy similarity1
Modified residuei652PhosphothreonineBy similarity1
Modified residuei1054PhosphoserineBy similarity1
Modified residuei1057PhosphoserineCombined sources1
Modified residuei1416PhosphoserineBy similarity1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1487PhosphoserineCombined sources1
Modified residuei1573PhosphoserineBy similarity1
Modified residuei1603PhosphoserineBy similarity1
Modified residuei1610PhosphoserineBy similarity1
Modified residuei1613PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O88658

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O88658

PRoteomics IDEntifications database

More...
PRIDEi
O88658

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O88658

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O88658

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in the brain with lower expression in testis and liver (at protein level). Isoform 1 is strongly expressed in the brain and ovary, with lower expression in lung, kidney, uterus, testis and liver. Isoform 2 is expressed in non-neuronal cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000057626 Expressed in 9 organ(s), highest expression level in Ammon's horn

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O88658 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O88658 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (By similarity).

Interacts with KIFBP (By similarity).

Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (PubMed:12204119).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P610234EBI-6143515,EBI-917838

GO - Molecular functioni

Protein-protein interaction databases

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O88658

Protein interaction database and analysis system

More...
IntActi
O88658, 5 interactors

Molecular INTeraction database

More...
MINTi
O88658

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000049243

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O88658

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 354Kinesin motorPROSITE-ProRule annotationAdd BLAST350
Domaini556 – 612FHAPROSITE-ProRule annotationAdd BLAST57
Domaini1701 – 1799PHPROSITE-ProRule annotationAdd BLAST99

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni270 – 350Interaction with KBPBy similarityAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili470 – 512Sequence analysisAdd BLAST43
Coiled coili672 – 731Sequence analysisAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi294 – 300Poly-Lys7
Compositional biasi1459 – 1462Poly-Arg4
Compositional biasi1521 – 1659Ser-richAdd BLAST139

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0245 Eukaryota
COG5059 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157445

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000165968

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O88658

KEGG Orthology (KO)

More...
KOi
K10392

Identification of Orthologs from Complete Genome Data

More...
OMAi
LHQEDEF

Database of Orthologous Groups

More...
OrthoDBi
76316at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O88658

TreeFam database of animal gene trees

More...
TreeFami
TF105221

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115 PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 1 hit
PF00169 PH, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O88658-1) [UniParc]FASTAAdd to basket
Also known as: KIF1Bbeta2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ SRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEDMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKQ DPETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLMDD
410 420 430 440 450
YSGSGGKYLK DFQNNKHRYL LASENQRPGN FSTASMGSLT SSPSSCSLNS
460 470 480 490 500
QAGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERNNT GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVAHPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK REKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PVPPELLPTE MGKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLDKLKQRLD
860 870 880 890 900
LMREMYDRAG EVGSNAQDDS ETTMTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDA MEDFDDEAFV DDTGSDAGTE
960 970 980 990 1000
EGSELFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFPSAA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVISPPEEV NRMNDLDLKS GTLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLGFYHVQ NIAVEVTESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQELN SPPQPSRRFF PPPMPLSRPV PATKLNTMNK TSLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKSLKSSHSS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRNLFGSGYS KSPDSNRVTG IYELSLCKMA
1460 1470 1480 1490 1500
DTGSPGMQRR RRKVLDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SIPKSMSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSAD IESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSISDCKLS DISPIGRDPS VSSFSSSTLT PSSTCPSLVD SRSSSMDQKT
1660 1670 1680 1690 1700
PEANSRASSP CQEFEQFQII PTVETPYLAR AGKNEFLNLV PDIEEVRAGS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLSSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MLKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQPKY
Length:1,816
Mass (Da):204,170
Last modified:December 20, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A6EBD08EBAC2BF9
GO
Isoform 2 (identifier: O88658-2) [UniParc]FASTAAdd to basket
Also known as: KIF1Bbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLMDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTA → T
     889-971: Missing.

Show »
Length:1,687
Mass (Da):189,886
Checksum:iBAD8173AFEB564DA
GO
Isoform 3 (identifier: O88658-3) [UniParc]FASTAAdd to basket
Also known as: KIF1B

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     342-342: L → LST
     394-408: IDPLMDDYSGSGGKY → N
     707-1816: Missing.

Show »
Length:688
Mass (Da):77,301
Checksum:i9BB02E07C1BC4C2D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K7Q8A0A0G2K7Q8_RAT
6-phosphogluconate dehydrogenase, d...
Kif1b
1,089Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2KA12A0A0G2KA12_RAT
Kinesin-like protein KIF1B
Kif1b
1,799Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti121 – 122QL → TC in AAC33292 (PubMed:9808286).Curated2
Sequence conflicti143 – 144EV → S in AAC33292 (PubMed:9808286).Curated2
Sequence conflicti242S → T in AAC33292 (PubMed:9808286).Curated1
Sequence conflicti269A → R in AAC33292 (PubMed:9808286).Curated1
Sequence conflicti533 – 534HL → QV in AAC33292 (PubMed:9808286).Curated2
Sequence conflicti557 – 558RV → KGF in AAC33292 (PubMed:9808286).Curated2
Sequence conflicti575H → HT in AAC33292 (PubMed:9808286).Curated1
Sequence conflicti622 – 627NRIIMG → TVSSWV in AAC33292 (PubMed:9808286).Curated6

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016617289 – 294Missing in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_016618342L → LST in isoform 3. 1 Publication1
Alternative sequenceiVSP_016619394 – 434IDPLM…NFSTA → T in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_016620394 – 408IDPLM…SGGKY → N in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_016621707 – 1816Missing in isoform 3. 1 PublicationAdd BLAST1110
Alternative sequenceiVSP_016622889 – 971Missing in isoform 2. 1 PublicationAdd BLAST83

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF083331 mRNA Translation: AAC33292.1
AB070355 mRNA Translation: BAB86917.1
AB120429 mRNA Translation: BAD51401.1

NCBI Reference Sequences

More...
RefSeqi
NP_476548.1, NM_057200.2 [O88658-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000079919; ENSRNOP00000075228; ENSRNOG00000057626 [O88658-2]
ENSRNOT00000080888; ENSRNOP00000072431; ENSRNOG00000057626 [O88658-2]
ENSRNOT00000087739; ENSRNOP00000074322; ENSRNOG00000057626 [O88658-1]
ENSRNOT00000089099; ENSRNOP00000075522; ENSRNOG00000057626 [O88658-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
117548

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:117548

UCSC genome browser

More...
UCSCi
RGD:621520 rat [O88658-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083331 mRNA Translation: AAC33292.1
AB070355 mRNA Translation: BAB86917.1
AB120429 mRNA Translation: BAD51401.1
RefSeqiNP_476548.1, NM_057200.2 [O88658-1]

3D structure databases

SMRiO88658
ModBaseiSearch...

Protein-protein interaction databases

CORUMiO88658
IntActiO88658, 5 interactors
MINTiO88658
STRINGi10116.ENSRNOP00000049243

PTM databases

iPTMnetiO88658
PhosphoSitePlusiO88658

Proteomic databases

jPOSTiO88658
PaxDbiO88658
PRIDEiO88658

Genome annotation databases

EnsembliENSRNOT00000079919; ENSRNOP00000075228; ENSRNOG00000057626 [O88658-2]
ENSRNOT00000080888; ENSRNOP00000072431; ENSRNOG00000057626 [O88658-2]
ENSRNOT00000087739; ENSRNOP00000074322; ENSRNOG00000057626 [O88658-1]
ENSRNOT00000089099; ENSRNOP00000075522; ENSRNOG00000057626 [O88658-1]
GeneIDi117548
KEGGirno:117548
UCSCiRGD:621520 rat [O88658-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23095
RGDi621520 Kif1b

Phylogenomic databases

eggNOGiKOG0245 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00940000157445
HOGENOMiHOG000165968
InParanoidiO88658
KOiK10392
OMAiLHQEDEF
OrthoDBi76316at2759
PhylomeDBiO88658
TreeFamiTF105221

Enzyme and pathway databases

ReactomeiR-RNO-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-RNO-983189 Kinesins

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O88658

Gene expression databases

BgeeiENSRNOG00000057626 Expressed in 9 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiO88658 baseline and differential
GenevisibleiO88658 RN

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR022164 Kinesin-like
IPR027640 Kinesin-like_fam
IPR022140 Kinesin-like_KIF1-typ
IPR032405 Kinesin_assoc
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00498 FHA, 1 hit
PF12423 KIF1B, 1 hit
PF00225 Kinesin, 1 hit
PF16183 Kinesin_assoc, 1 hit
PF00169 PH, 1 hit
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00129 KISc, 1 hit
SM00233 PH, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF1B_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O88658
Secondary accession number(s): Q65Z71, Q8R524
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: December 20, 2005
Last modified: November 13, 2019
This is version 167 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again