Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (08 May 2019)
Sequence version 2 (01 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein Wiz

Gene

Wiz

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. May be involved in EHMT1-EHMT2 heterodimer formation and stabilization.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri308 – 330C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri345 – 367C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri454 – 477C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri734 – 756C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri802 – 824C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri903 – 925C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1076 – 1098C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1260 – 1282C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1430 – 1452C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1629 – 1655C2H2-type 10PROSITE-ProRule annotationAdd BLAST27

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA-binding transcription factor activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW
  • nucleic acid binding Source: InterPro
  • SET domain binding Source: UniProtKB

GO - Biological processi

  • positive regulation of nuclear cell cycle DNA replication Source: MGI
  • protein heterotrimerization Source: UniProtKB
  • protein stabilization Source: UniProtKB
  • regulation of transcription, DNA-templated Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein Wiz
Alternative name(s):
Widely-interspaced zinc finger-containing protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Wiz
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1332638 Wiz

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1631C → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication1
Mutagenesisi1651H → A: Impairs interaction with EHMT1 and EHMT2. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002860551 – 1684Protein WizAdd BLAST1684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki916Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki972Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki988Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1000Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1021Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1029PhosphoserineBy similarity1
Modified residuei1031PhosphothreonineBy similarity1
Cross-linki1033Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1038Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1039PhosphoserineCombined sources1
Modified residuei1045PhosphoserineCombined sources1
Modified residuei1049PhosphothreonineCombined sources1
Modified residuei1050PhosphoserineCombined sources1
Modified residuei1058PhosphoserineBy similarity1
Cross-linki1089Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1112PhosphoserineBy similarity1
Modified residuei1139PhosphoserineBy similarity1
Cross-linki1141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1155PhosphoserineBy similarity1
Modified residuei1160PhosphoserineBy similarity1
Modified residuei1167PhosphoserineBy similarity1
Cross-linki1171Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1172Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1179PhosphoserineCombined sources1
Modified residuei1184PhosphoserineCombined sources1
Modified residuei1195N6,N6,N6-trimethyllysine; by EHMT2; alternateBy similarity1
Modified residuei1195N6,N6-dimethyllysine; by EHMT2; alternateBy similarity1
Cross-linki1210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1273Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1296PhosphoserineBy similarity1
Cross-linki1315Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1342PhosphoserineBy similarity1
Modified residuei1347PhosphoserineBy similarity1
Cross-linki1376Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1389Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1415Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1497Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1510Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1550PhosphoserineBy similarity1
Cross-linki1556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki1556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Cross-linki1567Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1593Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1663Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O88286

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O88286

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O88286

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O88286

PeptideAtlas

More...
PeptideAtlasi
O88286

PRoteomics IDEntifications database

More...
PRIDEi
O88286

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O88286

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O88286

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

According to PubMed:9795207, isoform L and isoform S are brain-specific. According to PubMed:16702210, isoform S is ubiquitously expressed.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform L and isoform S are expressed in brain from 14 dpc to adulthood, with highest levels in the perinatal period. At embryonic stages, isoform L seems to be excluded from cerebellum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024050 Expressed in 262 organ(s), highest expression level in olfactory bulb

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O88286 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O88286 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a complex containing at least CDYL, REST, WIZ, SETB1, EHMT1 and EHMT2 (By similarity). Interacts with EHMT1, EHMT2, CTBP1 and CTBP2.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
204563, 33 interactors

Protein interaction database and analysis system

More...
IntActi
O88286, 28 interactors

Molecular INTeraction database

More...
MINTi
O88286

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000069443

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1063 – 1067Interaction with CTBP1 and CTBP2 11 Publication5
Regioni1247 – 1251Interaction with CTBP1 and CTBP2 21 Publication5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi299 – 304Poly-Glu6
Compositional biasi601 – 608Poly-Glu8
Compositional biasi658 – 663Poly-Gln6
Compositional biasi786 – 790Poly-Lys5
Compositional biasi1174 – 1177Poly-Pro4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C2H2-type zinc finger 10 mediates interaction with EHMT1 and EHMT2.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri308 – 330C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri345 – 367C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri454 – 477C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri734 – 756C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri802 – 824C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri903 – 925C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1076 – 1098C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1260 – 1282C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1430 – 1452C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1629 – 1655C2H2-type 10PROSITE-ProRule annotationAdd BLAST27

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159979

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154859

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O88286

Identification of Orthologs from Complete Genome Data

More...
OMAi
WAPHEND

Database of Orthologous Groups

More...
OrthoDBi
434804at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O88286

TreeFam database of animal gene trees

More...
TreeFami
TF333705

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 11 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform L (identifier: O88286-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGLLAGGLA APDHPRGPAP REDIESGAEA AEGEGDIFPS SHYLPITKEG
60 70 80 90 100
PRDILDGRSG ISDGQPHPGL SEALPRATSA THRISSCYWD GDSLDFQPGS
110 120 130 140 150
PPPHLLGPFP ASLDVQGSWE HPMVQEAREG TPSEQRFKDS VIVRTMKPYA
160 170 180 190 200
KLKGSRKFLH HQGEVKFLEK YSPSHHKFDW LQDTDEQGPL KDTGLHLDLP
210 220 230 240 250
AQPPTVTSFR RVIVPVDNTP KTLDMEVMGT REDLEDFGQV AQPSEWGLHT
260 270 280 290 300
SASEVATQTW TVNSEASVER LQPLLSPVQT GPYLCELLQE VAGGVDSNEE
310 320 330 340 350
EEEEPAVFPC IECSIYFKHK EHLLEHMSQH RRAPGQEPPA DLAPLACSEC
360 370 380 390 400
GWAFTEPTAL EQHWQLHQAS REKIIEEIQK LKQFPGDEGR EARLQCSKCV
410 420 430 440 450
FGTNSSRAFM QHAKLHVRGS LPSRQATEPF RGGSPVLDVS TLVYPSYGDS
460 470 480 490 500
SGLNTCVHCG FTAPSKSLLR EHTRLVHAHH AHWEEVGEAF EDLTSQPCTS
510 520 530 540 550
QDAYTHSPDT ATVDYFSKSE PLLASVWQEN PSGYDPDLAF GPDYQQPGMR
560 570 580 590 600
NFPLLNSGQQ SLGKLAFPSP MASASYSIQR NRNKSTVHLQ RMEDKSHLWS
610 620 630 640 650
EEEEEEDEDV VLTSERDFTP ENGAFPPLAI PSLIPQPALE LKQTFQDALQ
660 670 680 690 700
AVDASETQQQ QLQGMVPIVL MAKLRPQVIA ATTRASPQLP PEEPELRSTH
710 720 730 740 750
PLDFLLLDAP LGGSLGLNTL LEGDPAMALK HEERKCPYCP DRFHYGIGLA
760 770 780 790 800
NHVRGHLNRV GVSYNVRHFI SAEEVKAIER RFSFQKKKKK VANFDPGTFS
810 820 830 840 850
LMRCDFCGAG FDTRAGLSSH ARAHLRDFGI TNWELTISPI NILQELLATS
860 870 880 890 900
AAELPPSPLG REPGGPPRSF LTSRRPRLPL TMPFPPTWAE DPGPIYGDAQ
910 920 930 940 950
SLTTCEVCGA CFETRKGLSS HARSHLRQLG VAESESSGAP IDLLYELVKQ
960 970 980 990 1000
KGLPDAPLGL TPSLTKKSNS PKEFLAGAAR PGLLTLAKPM DAPAVNKAIK
1010 1020 1030 1040 1050
SPPGFSAKGL THPSSSPLLK KAPLTLAGSP TPKNPEDKSP QLSLSPRPTS
1060 1070 1080 1090 1100
PKAQWPQSED EGPLNLTSGP EPTRDIRCEF CGEFFENRKG LSSHARSHLR
1110 1120 1130 1140 1150
QMGVTEWYVN GSPIDTLREI LKRRTQSRPG GHLHPPGPSP KALAKVLSTG
1160 1170 1180 1190 1200
GPGSSLEARS PSDLHISPLT KKLPPPPGSP LGHSPTASPP PTARKMFSGL
1210 1220 1230 1240 1250
ATPSLPKKLK PEHMRVEIKR EMLPGTLHGE PHPSEGPWGT PREDMAPLNL
1260 1270 1280 1290 1300
SARAEPVRDI RCEFCGEFFE NRKGLSSHAR SHLRQMGVTE WSVNGSPIDT
1310 1320 1330 1340 1350
LREILKKKSK LCLIKKEPPA GDLAPALTED GSPTAAPGAL HSPLPLSPLA
1360 1370 1380 1390 1400
SRPGKPGAGP TQVPRELSLS PITGSKPSAA SYLGPVATKR PLQEDRFLPA
1410 1420 1430 1440 1450
EVKAKTYIQT ELPFKAKTLH EKTSHSSTEA CCELCGLYFE NRKALASHAR
1460 1470 1480 1490 1500
AHLRQFGVTE WCVNGSPIET LSEWIKHRPQ KVGAYRSYIQ GGRPFTKKFR
1510 1520 1530 1540 1550
SAGHGRDSDK RPPLGLAPGG LSLVGRSAGG EPGLEAGRAA DSGERPLATS
1560 1570 1580 1590 1600
PPGTVKSEEH QRQNINKFER RQARPSDASA ARGGEEVNDL QQKLEEVRQP
1610 1620 1630 1640 1650
PPRVRPVPSL VPRPPQTSLV KFVGNIYTLK CRFCEVEFQG PLSIQEEWVR
1660 1670 1680
HLQRHILEMN FSKADPPPEE PQAPQAQTAA VEAP
Length:1,684
Mass (Da):184,291
Last modified:May 1, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i67BA8AC25A97DDEB
GO
Isoform S (identifier: O88286-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-790: Missing.

Show »
Length:956
Mass (Da):103,003
Checksum:i4DDE4A816FC04D65
GO
Isoform 2 (identifier: O88286-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.
     760-789: VGVSYNVRHFISAEEVKAIERRFSFQKKKK → MAEVAFLMGSPILASAKPSPVPPPPPIGSA
     898-898: D → DGLCSEENTMVAMDLGSPLLPKKSLPVSGTLEQVASRLSSKVAAEVPHGSKQELPDLK

Note: No experimental confirmation available.
Show »
Length:982
Mass (Da):105,637
Checksum:i1304FDF9672338FC
GO
Isoform 3 (identifier: O88286-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     745-798: YGIGLANHVR...KKVANFDPGT → NGIVLRPPAA...AQILLLRHQL
     799-1684: Missing.

Note: No experimental confirmation available.
Show »
Length:798
Mass (Da):88,329
Checksum:iCD980D3BFAD521B6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6ZBR8F6ZBR8_MOUSE
Protein Wiz
Wiz
965Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E8J8G5E8J8_MOUSE
MCG14253, isoform CRA_a
Wiz mCG_14253
955Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q1G2E9Q1G2_MOUSE
Protein Wiz
Wiz
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q5R9E9Q5R9_MOUSE
Protein Wiz
Wiz
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q5W4E9Q5W4_MOUSE
Protein Wiz
Wiz
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q869E9Q869_MOUSE
Protein Wiz
Wiz
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PZC6E9PZC6_MOUSE
Protein Wiz
Wiz
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti492D → G in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti868R → G in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti868R → G in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1020K → N in AAH53035 (PubMed:16141072).Curated1
Sequence conflicti1052K → R in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1052K → R in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1055W → C in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1055W → C in BAA32791 (PubMed:9795207).Curated1
Sequence conflicti1252Missing in BAA32790 (PubMed:9795207).Curated1
Sequence conflicti1252Missing in BAA32791 (PubMed:9795207).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

C57BL/6J and C57BR/cdJ mice specifically present an insertion of a type II early transposon in the opposite orientation into exon 6. This results in a strong reduction in the protein levels of isoform L.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0249531 – 759Missing in isoform 2. 1 PublicationAdd BLAST759
Alternative sequenceiVSP_02495463 – 790Missing in isoform S. 2 PublicationsAdd BLAST728
Alternative sequenceiVSP_024955745 – 798YGIGL…FDPGT → NGIVLRPPAARNVNGSTEKA ARAVREESRRGKRRNVAKTV TLIKAQILLLRHQL in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_024956760 – 789VGVSY…QKKKK → MAEVAFLMGSPILASAKPSP VPPPPPIGSA in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_024957799 – 1684Missing in isoform 3. 1 PublicationAdd BLAST886
Alternative sequenceiVSP_024958898D → DGLCSEENTMVAMDLGSPLL PKKSLPVSGTLEQVASRLSS KVAAEVPHGSKQELPDLK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB012265 mRNA Translation: BAA32790.1
AB012266 mRNA Translation: BAA32791.1
AB255388 mRNA Translation: BAE93139.1
AK004274 mRNA Translation: BAB23245.1
AK133564 mRNA Translation: BAE21728.1
BC053035 mRNA Translation: AAH53035.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28617.2 [O88286-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00247
T00248

NCBI Reference Sequences

More...
RefSeqi
NP_035847.2, NM_011717.4
NP_997603.3, NM_212438.3 [O88286-2]
XP_017172890.1, XM_017317401.1 [O88286-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000064694; ENSMUSP00000069443; ENSMUSG00000024050 [O88286-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22404

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:22404

UCSC genome browser

More...
UCSCi
uc008bwn.2 mouse [O88286-2]
uc008bwq.2 mouse [O88286-3]
uc008bwt.2 mouse [O88286-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB012265 mRNA Translation: BAA32790.1
AB012266 mRNA Translation: BAA32791.1
AB255388 mRNA Translation: BAE93139.1
AK004274 mRNA Translation: BAB23245.1
AK133564 mRNA Translation: BAE21728.1
BC053035 mRNA Translation: AAH53035.1
CCDSiCCDS28617.2 [O88286-2]
PIRiT00247
T00248
RefSeqiNP_035847.2, NM_011717.4
NP_997603.3, NM_212438.3 [O88286-2]
XP_017172890.1, XM_017317401.1 [O88286-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi204563, 33 interactors
IntActiO88286, 28 interactors
MINTiO88286
STRINGi10090.ENSMUSP00000069443

PTM databases

iPTMnetiO88286
PhosphoSitePlusiO88286

Proteomic databases

EPDiO88286
jPOSTiO88286
MaxQBiO88286
PaxDbiO88286
PeptideAtlasiO88286
PRIDEiO88286

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064694; ENSMUSP00000069443; ENSMUSG00000024050 [O88286-2]
GeneIDi22404
KEGGimmu:22404
UCSCiuc008bwn.2 mouse [O88286-2]
uc008bwq.2 mouse [O88286-3]
uc008bwt.2 mouse [O88286-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
58525
MGIiMGI:1332638 Wiz

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000159979
HOGENOMiHOG000154859
InParanoidiO88286
OMAiWAPHEND
OrthoDBi434804at2759
PhylomeDBiO88286
TreeFamiTF333705

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O88286

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024050 Expressed in 262 organ(s), highest expression level in olfactory bulb
ExpressionAtlasiO88286 baseline and differential
GenevisibleiO88286 MM

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWIZ_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O88286
Secondary accession number(s): O88287
, Q1XG03, Q3UZX7, Q7TSJ4, Q9CT89
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: May 8, 2019
This is version 152 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again