Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (18 Sep 2019)
Sequence version 2 (01 Jun 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Outer envelope pore protein 37, chloroplastic

Gene

OEP37

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Voltage-dependent peptide-sensitive high conductance rectifying cation channel with a strong affinity for TIC32 that is imported into the chloroplast. Conductance is pH-dependent decreasing with decreasing pH values.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionPorin
Biological processIon transport, Transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.B.47.1.2 the plastid outer envelope porin of 37 kda (oep37) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Outer envelope pore protein 37, chloroplastic
Alternative name(s):
Chloroplastic outer envelope pore protein of 37 kDa
Short name:
AtOEP37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OEP37
Ordered Locus Names:At2g43950
ORF Names:F6E13.8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G43950

The Arabidopsis Information Resource

More...
TAIRi
locus:2051844 AT2G43950

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini74 – 76Cytoplasmic3
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei77 – 86Beta stranded; Name=1Sequence analysis10
Topological domaini87 – 103Chloroplast intermembraneAdd BLAST17
Transmembranei104 – 113Beta stranded; Name=2Sequence analysis10
Topological domaini114 – 129CytoplasmicAdd BLAST16
Transmembranei130 – 137Beta stranded; Name=3Sequence analysis8
Topological domaini138 – 154Chloroplast intermembraneAdd BLAST17
Transmembranei155 – 164Beta stranded; Name=4Sequence analysis10
Topological domaini165 – 169Cytoplasmic5
Transmembranei170 – 178Beta stranded; Name=5Sequence analysis9
Topological domaini179 – 219Chloroplast intermembraneAdd BLAST41
Transmembranei220 – 228Beta stranded; Name=6Sequence analysis9
Topological domaini229 – 230Cytoplasmic2
Transmembranei231 – 240Beta stranded; Name=7Sequence analysis10
Topological domaini241Chloroplast intermembrane1
Transmembranei242 – 250Beta stranded; Name=8Sequence analysis9
Topological domaini251 – 257Cytoplasmic7
Transmembranei258 – 267Beta stranded; Name=9Sequence analysis10
Topological domaini268 – 269Chloroplast intermembrane2
Transmembranei270 – 279Beta stranded; Name=10Sequence analysis10
Topological domaini280 – 286Cytoplasmic7
Transmembranei287 – 296Beta stranded; Name=11Sequence analysis10
Topological domaini297 – 316Chloroplast intermembraneAdd BLAST20
Transmembranei317 – 326Beta stranded; Name=12Sequence analysis10
Topological domaini327 – 343CytoplasmicAdd BLAST17

Keywords - Cellular componenti

Chloroplast, Membrane, Plastid, Plastid outer membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 73ChloroplastSequence analysisAdd BLAST73
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041571174 – 343Outer envelope pore protein 37, chloroplasticAdd BLAST270

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O80565

PRoteomics IDEntifications database

More...
PRIDEi
O80565

PTM databases

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O80565

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed at low levels. Mostly present in cotyledons, and accumulates in seedlings and embryos.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

During seed development, confined to green cotyledons of mature embryos. In germinating seedlings, detected in cotyledons and the root hair zone of the primary root. In older seedlings, restricted to cotyledons.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O80565 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O80565 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms an hourglass-shaped multimeric complex.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
4336, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O80565, 2 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT2G43950.1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide, Transmembrane, Transmembrane beta strand

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ87 Eukaryota
ENOG410ZZSD LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000239249

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O80565

Identification of Orthologs from Complete Genome Data

More...
OMAi
DSNYWSA

Database of Orthologous Groups

More...
OrthoDBi
958058at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O80565

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038951 OEP37-like

The PANTHER Classification System

More...
PANTHERi
PTHR35484 PTHR35484, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O80565-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADPSSQNPN LATPPPPSSP SPTHQIQSGT SELSPPSRPP CSTLSFLKTA
60 70 80 90 100
NRPKLRVTSE FDSDSLLFLN KVSCKLFDNL AKLKLSFQNN SQREISQPQV
110 120 130 140 150
SFTSKHVSVL YDVEEKNTFI KSTLDVHPRL QLRALHNVKA QQGEVAMEAN
160 170 180 190 200
LTEPGYSLEL SSPVPIGYPR ATLKFPLGEI SLQEKDEEEE EKQKRTLSVN
210 220 230 240 250
GILKRQVMNG VCTALYTDEE LRLRYAYKDD ALSFIPSISL PSNAASFAFK
260 270 280 290 300
RRFSPSDKLS YWYNFDSNMW SAVYKRTYGK DYKLKAGYDS DVRLGWASLW
310 320 330 340
VGDEAGKVKT TPMKMKVQFM LQVPQDDIKS SVLMFRVKKR WDI
Length:343
Mass (Da):38,835
Last modified:June 1, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFB26B8C037EF7169
GO
Isoform 2 (identifier: O80565-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     302-343: GDEAGKVKTTPMKMKVQFMLQVPQDDIKSSVLMFRVKKRWDI → NHQPLVFFSLFSHQRNLFTRLSPNPSHTSKML

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:333
Mass (Da):37,707
Checksum:iC9499669776F61D8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042323302 – 343GDEAG…KRWDI → NHQPLVFFSLFSHQRNLFTR LSPNPSHTSKML in isoform 2. CuratedAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC004005 Genomic DNA Translation: AAC23403.2
CP002685 Genomic DNA Translation: AEC10352.1
CP002685 Genomic DNA Translation: AEC10354.1
AY045937 mRNA Translation: AAK76611.1
AY079409 mRNA Translation: AAL85140.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T00675

NCBI Reference Sequences

More...
RefSeqi
NP_566003.1, NM_129957.4 [O80565-1]
NP_850405.2, NM_180074.3 [O80565-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G43950.1; AT2G43950.1; AT2G43950 [O80565-1]
AT2G43950.2; AT2G43950.2; AT2G43950 [O80565-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
819000

Gramene; a comparative resource for plants

More...
Gramenei
AT2G43950.1; AT2G43950.1; AT2G43950 [O80565-1]
AT2G43950.2; AT2G43950.2; AT2G43950 [O80565-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G43950

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC004005 Genomic DNA Translation: AAC23403.2
CP002685 Genomic DNA Translation: AEC10352.1
CP002685 Genomic DNA Translation: AEC10354.1
AY045937 mRNA Translation: AAK76611.1
AY079409 mRNA Translation: AAL85140.1
PIRiT00675
RefSeqiNP_566003.1, NM_129957.4 [O80565-1]
NP_850405.2, NM_180074.3 [O80565-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi4336, 1 interactor
IntActiO80565, 2 interactors
STRINGi3702.AT2G43950.1

Protein family/group databases

TCDBi1.B.47.1.2 the plastid outer envelope porin of 37 kda (oep37) family

PTM databases

SwissPalmiO80565

Proteomic databases

PaxDbiO80565
PRIDEiO80565

Genome annotation databases

EnsemblPlantsiAT2G43950.1; AT2G43950.1; AT2G43950 [O80565-1]
AT2G43950.2; AT2G43950.2; AT2G43950 [O80565-2]
GeneIDi819000
GrameneiAT2G43950.1; AT2G43950.1; AT2G43950 [O80565-1]
AT2G43950.2; AT2G43950.2; AT2G43950 [O80565-2]
KEGGiath:AT2G43950

Organism-specific databases

AraportiAT2G43950
TAIRilocus:2051844 AT2G43950

Phylogenomic databases

eggNOGiENOG410IJ87 Eukaryota
ENOG410ZZSD LUCA
HOGENOMiHOG000239249
InParanoidiO80565
OMAiDSNYWSA
OrthoDBi958058at2759
PhylomeDBiO80565

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O80565

Gene expression databases

ExpressionAtlasiO80565 baseline and differential
GenevisibleiO80565 AT

Family and domain databases

InterProiView protein in InterPro
IPR038951 OEP37-like
PANTHERiPTHR35484 PTHR35484, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOEP37_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O80565
Secondary accession number(s): F4IT23, F4IT24, Q94AM0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 22, 2012
Last sequence update: June 1, 2002
Last modified: September 18, 2019
This is version 107 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again