Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA fragmentation factor subunit beta

Gene

DFFB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology.

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by DFFA (DFF45).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • deoxyribonuclease activity Source: CAFA
  • disordered domain specific binding Source: CAFA
  • enzyme binding Source: UniProtKB
  • identical protein binding Source: CAFA
  • protein domain specific binding Source: CAFA

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Nuclease
Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-211227 Activation of DNA fragmentation factor

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O76075

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O76075

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA fragmentation factor subunit beta (EC:3.-.-.-)
Alternative name(s):
Caspase-activated deoxyribonuclease
Short name:
CAD
Short name:
Caspase-activated DNase
Caspase-activated nuclease
Short name:
CPAN
DNA fragmentation factor 40 kDa subunit
Short name:
DFF-40
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DFFB
Synonyms:CAD, DFF2, DFF40
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000169598.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2773 DFFB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601883 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O76075

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1677

Open Targets

More...
OpenTargetsi
ENSG00000169598

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27255

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DFFB

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001447131 – 338DNA fragmentation factor subunit betaAdd BLAST338

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O76075

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O76075

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O76075

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O76075

PeptideAtlas

More...
PeptideAtlasi
O76075

PRoteomics IDEntifications database

More...
PRIDEi
O76075

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50376
50377 [O76075-2]
50378 [O76075-3]
50379 [O76075-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O76075

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O76075

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169598 Expressed in 170 organ(s), highest expression level in cerebellar hemisphere

CleanEx database of gene expression profiles

More...
CleanExi
HS_CAD
HS_DFFB

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O76075 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O76075 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004328
HPA052904

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of DFFA and DFFB. Interacts with HIST1H1A.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
DFFAO002733EBI-1053821,EBI-727171

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108041, 21 interactors

Protein interaction database and analysis system

More...
IntActi
O76075, 8 interactors

Molecular INTeraction database

More...
MINTi
O76075

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367454

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1338
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IBXNMR-A1-80[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O76075

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O76075

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O76075

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 80CIDE-NPROSITE-ProRule annotationAdd BLAST77

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFTE Eukaryota
ENOG41102TS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014490

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006502

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003828

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O76075

KEGG Orthology (KO)

More...
KOi
K02311

Database of Orthologous Groups

More...
OrthoDBi
1254881at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O76075

TreeFam database of animal gene trees

More...
TreeFami
TF102022

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003508 CIDE-N_dom
IPR039729 DFF40
IPR015311 DFF40_C

The PANTHER Classification System

More...
PANTHERi
PTHR13067 PTHR13067, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02017 CIDE-N, 1 hit
PF09230 DFF40, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00266 CAD, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51135 CIDE_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: O76075-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQKPKSVKL RALRSPRKFG VAGRSCQEVL RKGCLRFQLP ERGSRLCLYE
60 70 80 90 100
DGTELTEDYF PSVPDNAELV LLTLGQAWQG YVSDIRRFLS AFHEPQVGLI
110 120 130 140 150
QAAQQLLCDE QAPQRQRLLA DLLHNVSQNI AAETRAEDPP WFEGLESRFQ
160 170 180 190 200
SKSGYLRYSC ESRIRSYLRE VSSYPSTVGA EAQEEFLRVL GSMCQRLRSM
210 220 230 240 250
QYNGSYFDRG AKGGSRLCTP EGWFSCQGPF DMDSCLSRHS INPYSNRESR
260 270 280 290 300
ILFSTWNLDH IIEKKRTIIP TLVEAIKEQD GREVDWEYFY GLLFTSENLK
310 320 330
LVHIVCHKKT THKLNCDPSR IYKPQTRLKR KQPVRKRQ
Length:338
Mass (Da):39,110
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0B0F3F8D91209389
GO
Isoform Beta (identifier: O76075-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-338: IEKKRTIIPT...KRKQPVRKRQ → DGVLLCGPG

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:270
Mass (Da):30,649
Checksum:i26AC88793BE46E7E
GO
Isoform Gamma (identifier: O76075-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-116: YVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQ → SVGVRARTKTRDTSSLSPGDCQALGNGGRCGQRLFL
     117-338: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:116
Mass (Da):12,800
Checksum:iF6C9A328ACBB54EE
GO
Isoform Delta (identifier: O76075-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-103: YVSDIRRFLSAFHEPQVGLIQAA → WFCHVSQDSLTLLGSSCPPALVS
     104-338: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:103
Mass (Da):11,482
Checksum:iF9BDC40AC25E4500
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DZS0B4DZS0_HUMAN
DNA fragmentation factor subunit be...
DFFB
362Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KT26J3KT26_HUMAN
DNA fragmentation factor subunit be...
DFFB
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q96P72Q96P72_HUMAN
DNA fragmentation factor subunit be...
DFFB
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q96P73Q96P73_HUMAN
DFFB protein
DFFB hCG_31570
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3XAD0G3XAD0_HUMAN
DNA fragmentation factor subunit be...
DFFB hCG_31570
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J1S5A0A0B4J1S5_HUMAN
DNA fragmentation factor subunit be...
DFFB
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_009305196R → K1 PublicationCorresponds to variant dbSNP:rs12738235Ensembl.1
Natural variantiVAR_048737277K → R. Corresponds to variant dbSNP:rs12564400Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00108181 – 116YVSDI…APQRQ → SVGVRARTKTRDTSSLSPGD CQALGNGGRCGQRLFL in isoform Gamma. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_00108381 – 103YVSDI…LIQAA → WFCHVSQDSLTLLGSSCPPA LVS in isoform Delta. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_001084104 – 338Missing in isoform Delta. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_001082117 – 338Missing in isoform Gamma. 1 PublicationAdd BLAST222
Alternative sequenceiVSP_001080262 – 338IEKKR…VRKRQ → DGVLLCGPG in isoform Beta. 1 PublicationAdd BLAST77

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF064019 mRNA Translation: AAC39920.1
AB013918 mRNA Translation: BAA32250.1
AF039210 mRNA Translation: AAC39709.1
AB028911 mRNA Translation: BAB40447.1
AB028912 mRNA Translation: BAB40448.1
AB028913 mRNA Translation: BAB40449.1
AK290877 mRNA Translation: BAF83566.1
AL691523 Genomic DNA No translation available.
BC048797 mRNA Translation: AAH48797.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52.1 [O76075-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001307061.1, NM_001320132.1
NP_004393.1, NM_004402.3 [O76075-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.133089

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339350; ENSP00000343218; ENSG00000169598 [O76075-3]
ENST00000378209; ENSP00000367454; ENSG00000169598 [O76075-1]
ENST00000491998; ENSP00000436775; ENSG00000169598 [O76075-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1677

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1677

UCSC genome browser

More...
UCSCi
uc001alc.5 human [O76075-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064019 mRNA Translation: AAC39920.1
AB013918 mRNA Translation: BAA32250.1
AF039210 mRNA Translation: AAC39709.1
AB028911 mRNA Translation: BAB40447.1
AB028912 mRNA Translation: BAB40448.1
AB028913 mRNA Translation: BAB40449.1
AK290877 mRNA Translation: BAF83566.1
AL691523 Genomic DNA No translation available.
BC048797 mRNA Translation: AAH48797.1
CCDSiCCDS52.1 [O76075-1]
RefSeqiNP_001307061.1, NM_001320132.1
NP_004393.1, NM_004402.3 [O76075-1]
UniGeneiHs.133089

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1IBXNMR-A1-80[»]
ProteinModelPortaliO76075
SMRiO76075
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108041, 21 interactors
IntActiO76075, 8 interactors
MINTiO76075
STRINGi9606.ENSP00000367454

PTM databases

iPTMnetiO76075
PhosphoSitePlusiO76075

Polymorphism and mutation databases

BioMutaiDFFB

Proteomic databases

EPDiO76075
jPOSTiO76075
MaxQBiO76075
PaxDbiO76075
PeptideAtlasiO76075
PRIDEiO76075
ProteomicsDBi50376
50377 [O76075-2]
50378 [O76075-3]
50379 [O76075-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339350; ENSP00000343218; ENSG00000169598 [O76075-3]
ENST00000378209; ENSP00000367454; ENSG00000169598 [O76075-1]
ENST00000491998; ENSP00000436775; ENSG00000169598 [O76075-2]
GeneIDi1677
KEGGihsa:1677
UCSCiuc001alc.5 human [O76075-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1677
DisGeNETi1677
EuPathDBiHostDB:ENSG00000169598.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DFFB
HGNCiHGNC:2773 DFFB
HPAiCAB004328
HPA052904
MIMi601883 gene
neXtProtiNX_O76075
OpenTargetsiENSG00000169598
PharmGKBiPA27255

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFTE Eukaryota
ENOG41102TS LUCA
GeneTreeiENSGT00390000014490
HOGENOMiHOG000006502
HOVERGENiHBG003828
InParanoidiO76075
KOiK02311
OrthoDBi1254881at2759
PhylomeDBiO76075
TreeFamiTF102022

Enzyme and pathway databases

ReactomeiR-HSA-211227 Activation of DNA fragmentation factor
SignaLinkiO76075
SIGNORiO76075

Miscellaneous databases

EvolutionaryTraceiO76075

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DFFB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1677

Protein Ontology

More...
PROi
PR:O76075

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169598 Expressed in 170 organ(s), highest expression level in cerebellar hemisphere
CleanExiHS_CAD
HS_DFFB
ExpressionAtlasiO76075 baseline and differential
GenevisibleiO76075 HS

Family and domain databases

InterProiView protein in InterPro
IPR003508 CIDE-N_dom
IPR039729 DFF40
IPR015311 DFF40_C
PANTHERiPTHR13067 PTHR13067, 1 hit
PfamiView protein in Pfam
PF02017 CIDE-N, 1 hit
PF09230 DFF40, 1 hit
SMARTiView protein in SMART
SM00266 CAD, 1 hit
PROSITEiView protein in PROSITE
PS51135 CIDE_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDFFB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O76075
Secondary accession number(s): O60521
, Q5SR22, Q9BYI4, Q9BYI5, Q9BYI6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1998
Last modified: January 16, 2019
This is version 166 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again