UniProtKB - O76071 (CIAO1_HUMAN)

BLAST

>sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGH
QRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLL
ATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREE
EDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPS
WKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
AHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Align
Format
Add to basket Added to basket
History
Entry version 171 (07 Nov 2018)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Probable cytosolic iron-sulfur protein assembly protein CIAO1

Gene

CIAO1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:17937914, PubMed:23891004). As a CIA complex component, interacts specifically with CIAO2A or CIAO2B and MMS19 to assist different branches of iron-sulfur protein assembly, depending of its interactors. The complex CIAO1:CIAO2B:MMS19 binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. CIAO1:CIAO2A specifically matures ACO1 and stabilizes IREB2 (PubMed:23891004). Seems to specifically modulate the transactivation activity of WT1 (PubMed:9556563). As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation (PubMed:20797633).UniRule annotation4 Publications

Miscellaneous

'Ciao' means 'bridge' in Chinese.

GO - Biological processⁱ

chromosome segregation Source: UniProtKB-KW
iron-sulfur cluster assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23891004
positive regulation of cell proliferation
Source: ProtInc
Traceable author statementⁱ
- 9556563
protein maturation by iron-sulfur cluster transfer
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23891004
regulation of transcription by RNA polymerase II
Source: ProtInc
Traceable author statementⁱ
- 9556563

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Chromosome partition

Biological process

Chromosome partition

Enzyme and pathway databases

Reactomeⁱ	R-HSA-2564830 Cytosolic iron-sulfur cluster assembly
SignaLinkⁱ	O76071

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Probable cytosolic iron-sulfur protein assembly protein CIAO1UniRule annotation Alternative name(s): WD repeat-containing protein 39UniRule annotation
Gene namesⁱ	Name:CIAO1UniRule annotation Synonyms:CIA11 Publication, WDR39
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000144021.2
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:14280 CIAO1
MIMⁱ	604333 gene
neXtProtⁱ	NX_O76071

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	9391
Open Targets More...OpenTargetsⁱ	ENSG00000144021
PharmGKBⁱ	PA162382269

Polymorphism and mutation databases

BioMutaⁱ	CIAO1

BioMutaⁱ

CIAO1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000051389	1 – 339	Probable cytosolic iron-sulfur protein assembly protein CIAO1Add BLAST		339

Proteomic databases

EPDⁱ	O76071
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O76071
PaxDbⁱ	O76071
PeptideAtlas More...PeptideAtlasⁱ	O76071
PRIDEⁱ	O76071
ProteomicsDBⁱ	50373
TopDownProteomicsⁱ	O76071

PTM databases

iPTMnetⁱ	O76071
PhosphoSitePlusⁱ	O76071

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000144021 Expressed in 219 organ(s), highest expression level in right adrenal gland
CleanExⁱ	HS_CIAO1
Genevisibleⁱ	O76071 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA017882

HPAⁱ

HPA017882

Interactionⁱ

Subunit structureⁱ

Component of the CIA complex (PubMed:22678361, PubMed:22678362, PubMed:23585563). Interacts with CIAO2A and forms a complex with CIAO2B and MMS19; the interactions with CIAO2A and CIAO2B are mutually exclusive (PubMed:22683786, PubMed:23891004, PubMed:23585563). Interacts with CHD1L, ERCC2, IREB2 and POLD1 (PubMed:23891004). Component of the MMXD complex, which includes CIAO1, ERCC2, CIAO2B, MMS19 and SLC25A5 (PubMed:20797633). Interacts with WT1 (PubMed:9556563). Interacts with CIAO3 (PubMed:23585563).UniRule annotation7 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
FAM96A	Q9H5X1	10	EBI-725145,EBI-752069
FAM96B	Q9Y3D0	17	EBI-725145,EBI-744045
MEOX1	P50221	3	EBI-725145,EBI-2864512
MMS19	Q96T76	9	EBI-725145,EBI-1044169
MMS19	Q96T76-8	5	EBI-725145,EBI-10190644
RSAD2	Q8WXG1	2	EBI-725145,EBI-12736320
SF1	Q15637	3	EBI-725145,EBI-744603

Protein-protein interaction databases

BioGridⁱ	114791, 85 interactors
IntActⁱ	O76071, 26 interactors
Molecular INTeraction database More...MINTⁱ	O76071
STRINGⁱ	9606.ENSP00000418287

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	5 – 11	Combined sources	7
Beta strandⁱ	19 – 24	Combined sources	6
Beta strandⁱ	31 – 35	Combined sources	5
Beta strandⁱ	40 – 46	Combined sources	7
Beta strandⁱ	49 – 56	Combined sources	8
Beta strandⁱ	64 – 69	Combined sources	6
Beta strandⁱ	73 – 80	Combined sources	8
Beta strandⁱ	85 – 90	Combined sources	6
Beta strandⁱ	95 – 101	Combined sources	7
Beta strandⁱ	108 – 113	Combined sources	6
Beta strandⁱ	117 – 124	Combined sources	8
Beta strandⁱ	129 – 134	Combined sources	6
Beta strandⁱ	140 – 146	Combined sources	7
Beta strandⁱ	153 – 158	Combined sources	6
Beta strandⁱ	160 – 163	Combined sources	4
Beta strandⁱ	165 – 169	Combined sources	5
Beta strandⁱ	174 – 180	Combined sources	7
Beta strandⁱ	183 – 190	Combined sources	8
Beta strandⁱ	197 – 202	Combined sources	6
Beta strandⁱ	206 – 213	Combined sources	8
Beta strandⁱ	218 – 224	Combined sources	7
Beta strandⁱ	240 – 247	Combined sources	8
Beta strandⁱ	255 – 260	Combined sources	6
Turnⁱ	262 – 264	Combined sources	3
Beta strandⁱ	267 – 271	Combined sources	5
Beta strandⁱ	276 – 281	Combined sources	6
Beta strandⁱ	292 – 298	Combined sources	7
Beta strandⁱ	301 – 304	Combined sources	4
Beta strandⁱ	306 – 311	Combined sources	6
Beta strandⁱ	313 – 315	Combined sources	3
Beta strandⁱ	318 – 323	Combined sources	6
Beta strandⁱ	328 – 333	Combined sources	6

Show more details

3D structure databases

ProteinModelPortalⁱ	O76071
SMRⁱ	O76071
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O76071

EvolutionaryTraceⁱ

O76071

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Repeatⁱ	14 – 53	WD 1Add BLAST	40
Repeatⁱ	59 – 98	WD 2Add BLAST	40
Repeatⁱ	103 – 142	WD 3Add BLAST	40
Repeatⁱ	148 – 187	WD 4Add BLAST	40
Repeatⁱ	192 – 231	WD 5Add BLAST	40
Repeatⁱ	250 – 289	WD 6Add BLAST	40
Repeatⁱ	301 – 339	WD 7Add BLAST	39

Sequence similaritiesⁱ

Belongs to the WD repeat CIA1 family.UniRule annotation

Keywords - Domainⁱ

Repeat, WD repeat

Phylogenomic databases

eggNOGⁱ	KOG0645 Eukaryota ENOG410XRMA LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00890000139406
HOGENOMⁱ	HOG000208901
HOVERGENⁱ	HBG056532
InParanoidⁱ	O76071
OMAⁱ	EFECAAV
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0AAM
PhylomeDBⁱ	O76071
TreeFamⁱ	TF318181

Family and domain databases

Gene3Dⁱ	2.130.10.10, 1 hit
HAMAPⁱ	MF_03037 ciao1, 1 hit
InterProⁱ	View protein in InterPro IPR028608 CIAO1/Cia1 IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR019775 WD40_repeat_CS IPR017986 WD40_repeat_dom IPR036322 WD40_repeat_dom_sf
PANTHERⁱ	PTHR19920 PTHR19920, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00400 WD40, 6 hits
SMARTⁱ	View protein in SMART SM00320 WD40, 7 hits
SUPFAMⁱ	SSF50978 SSF50978, 1 hit
PROSITEⁱ	View protein in PROSITE PS00678 WD_REPEATS_1, 1 hit PS50082 WD_REPEATS_2, 6 hits PS50294 WD_REPEATS_REGION, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

O76071-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MKDSLVLLGR VPAHPDSRCW FLAWNPAGTL LASCGGDRRI RIWGTEGDSW 
        60         70         80         90        100
ICKSVLSEGH QRTVRKVAWS PCGNYLASAS FDATTCIWKK NQDDFECVTT 
       110        120        130        140        150
LEGHENEVKS VAWAPSGNLL ATCSRDKSVW VWEVDEEDEY ECVSVLNSHT 
       160        170        180        190        200
QDVKHVVWHP SQELLASASY DDTVKLYREE EDDWVCCATL EGHESTVWSL 
       210        220        230        240        250
AFDPSGQRLA SCSDDRTVRI WRQYLPGNEQ GVACSGSDPS WKCICTLSGF 
       260        270        280        290        300
HSRTIYDIAW CQLTGALATA CGDDAIRVFQ EDPNSDPQQP TFSLTAHLHQ 
       310        320        330 
AHSQDVNCVA WNPKEPGLLA SCSDDGEVAF WKYQRPEGL

Length:339

Mass (Da):37,840

Last modified:November 1, 1998 - v1

Checksum:ⁱ63A8D8257A204FC8

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	243	C → G in BAD96977 (Ref. 5) Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U63810 mRNA Translation: AAC24948.1 EF011618 mRNA Translation: ABK41108.1 AC004020 Genomic DNA Translation: AAC23493.1 CR456802 mRNA Translation: CAG33083.1 AK223257 mRNA Translation: BAD96977.1 BC001395 mRNA Translation: AAH01395.1 BC032812 mRNA Translation: AAH32812.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2019.1
NCBI Reference Sequences More...RefSeqⁱ	NP_004795.1, NM_004804.2
UniGeneⁱ	Hs.12109

Genome annotation databases

Ensemblⁱ	ENST00000488633; ENSP00000418287; ENSG00000144021
GeneIDⁱ	9391
KEGGⁱ	hsa:9391
UCSC genome browser More...UCSCⁱ	uc002svs.4 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1		PANTR		339	UniRef100_O76071
Probable cytosolic iron-sulfur protein assembly protein CIAO1		PAPAN		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		CHLSB		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		GORGO		339
UPI00027F4E90		PAPAN		414

Protein	Similar proteins		Species	Score	Length	Source
O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1		RAT		339	UniRef90_O76071
Probable cytosolic iron-sulfur protein assembly protein CIAO1		MOUSE		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		BOVIN		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		PANTR		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		PAPAN		339
+113

Protein	Similar proteins		Species	Score	Length	Source
O76071	Probable cytosolic iron-sulfur protein assembly protein CIAO1		RAT		339	UniRef50_O76071
Probable cytosolic iron-sulfur protein assembly protein CIAO1		MOUSE		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		BOVIN		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		PANTR		339
Probable cytosolic iron-sulfur protein assembly protein CIAO1		PAPAN		339
+114

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U63810 mRNA Translation: AAC24948.1 EF011618 mRNA Translation: ABK41108.1 AC004020 Genomic DNA Translation: AAC23493.1 CR456802 mRNA Translation: CAG33083.1 AK223257 mRNA Translation: BAD96977.1 BC001395 mRNA Translation: AAH01395.1 BC032812 mRNA Translation: AAH32812.1
CCDSⁱ	CCDS2019.1
RefSeqⁱ	NP_004795.1, NM_004804.2
UniGeneⁱ	Hs.12109

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3FM0	X-ray	1.70	A	1-339	[»]
ProteinModelPortalⁱ	O76071
SMRⁱ	O76071
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114791, 85 interactors
IntActⁱ	O76071, 26 interactors
MINTⁱ	O76071
STRINGⁱ	9606.ENSP00000418287

PTM databases

iPTMnetⁱ	O76071
PhosphoSitePlusⁱ	O76071

Polymorphism and mutation databases

BioMutaⁱ	CIAO1

BioMutaⁱ

CIAO1

Proteomic databases

EPDⁱ	O76071
MaxQBⁱ	O76071
PaxDbⁱ	O76071
PeptideAtlasⁱ	O76071
PRIDEⁱ	O76071
ProteomicsDBⁱ	50373
TopDownProteomicsⁱ	O76071

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	9391
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000488633; ENSP00000418287; ENSG00000144021
GeneIDⁱ	9391
KEGGⁱ	hsa:9391
UCSCⁱ	uc002svs.4 human

Organism-specific databases

CTDⁱ	9391
DisGeNETⁱ	9391
EuPathDBⁱ	HostDB:ENSG00000144021.2
GeneCardsⁱ	CIAO1
HGNCⁱ	HGNC:14280 CIAO1
HPAⁱ	HPA017882
MIMⁱ	604333 gene
neXtProtⁱ	NX_O76071
OpenTargetsⁱ	ENSG00000144021
PharmGKBⁱ	PA162382269
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0645 Eukaryota ENOG410XRMA LUCA
GeneTreeⁱ	ENSGT00890000139406
HOGENOMⁱ	HOG000208901
HOVERGENⁱ	HBG056532
InParanoidⁱ	O76071
OMAⁱ	EFECAAV
OrthoDBⁱ	EOG091G0AAM
PhylomeDBⁱ	O76071
TreeFamⁱ	TF318181

Enzyme and pathway databases

Reactomeⁱ	R-HSA-2564830 Cytosolic iron-sulfur cluster assembly
SignaLinkⁱ	O76071

Miscellaneous databases

ChiTaRSⁱ	CIAO1 human
EvolutionaryTraceⁱ	O76071
GeneWikiⁱ	CIAO1
GenomeRNAiⁱ	9391
Protein Ontology More...PROⁱ	PR:O76071
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000144021 Expressed in 219 organ(s), highest expression level in right adrenal gland
CleanExⁱ	HS_CIAO1
Genevisibleⁱ	O76071 HS

Family and domain databases

Gene3Dⁱ	2.130.10.10, 1 hit
HAMAPⁱ	MF_03037 ciao1, 1 hit
InterProⁱ	View protein in InterPro IPR028608 CIAO1/Cia1 IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR019775 WD40_repeat_CS IPR017986 WD40_repeat_dom IPR036322 WD40_repeat_dom_sf
PANTHERⁱ	PTHR19920 PTHR19920, 1 hit
Pfamⁱ	View protein in Pfam PF00400 WD40, 6 hits
SMARTⁱ	View protein in SMART SM00320 WD40, 7 hits
SUPFAMⁱ	SSF50978 SSF50978, 1 hit
PROSITEⁱ	View protein in PROSITE PS00678 WD_REPEATS_1, 1 hit PS50082 WD_REPEATS_2, 6 hits PS50294 WD_REPEATS_REGION, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CIAO1_HUMAN
Accessionⁱ	O76071Primary (citable) accession number: O76071 Secondary accession number(s): A0MNN9, Q53FM5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	January 11, 2001
	Last sequence update:	November 1, 1998
	Last modified:	November 7, 2018
	This is version 171 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O76071 (CIAO1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Probable cytosolic iron-sulfur protein assembly protein CIAO1

CIAO1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytoskeleton

Cytosol

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ