Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - O76054 (S14L2_HUMAN)

Entry version 187 (23 Feb 2022)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

SEC14-like protein 2

Gene

SEC14L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation, Transport
LigandLipid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O76054

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O76054

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SEC14-like protein 2
Alternative name(s):
Alpha-tocopherol-associated protein
Short name:
TAP
Short name:
hTAP
Squalene transfer protein
Supernatant protein factor
Short name:
SPF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEC14L2
Synonyms:C22orf6, KIAA1186, KIAA1658
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10699, SEC14L2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607558, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O76054

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000100003

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		23541

Open Targets

More...OpenTargetsi		ENSG00000100003

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35622

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O76054, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB14003, alpha-Tocopherol acetate
DB14001, alpha-Tocopherol succinate
DB14002, D-alpha-Tocopherol acetate
DB11635, Tocofersolan
DB11251, Tocopherol
DB00163, Vitamin E

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SEC14L2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002107551 – 403SEC14-like protein 2Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei51N6-succinyllysineBy similarity1
Modified residuei253N6-succinyllysineBy similarity1
Modified residuei257N6-succinyllysineBy similarity1
Modified residuei393N6-succinyllysineBy similarity1

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O76054

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O76054

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O76054

MaxQB - The MaxQuant DataBase

More...MaxQBi		O76054

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O76054

PeptideAtlas

More...PeptideAtlasi		O76054

PRoteomics IDEntifications database

More...PRIDEi		O76054

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		26377
50365 [O76054-1]
50366 [O76054-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O76054

MetOSite database of methionine sulfoxide sites

More...MetOSitei		O76054

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O76054

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O76054

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Strong expression in liver, brain and prostate.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Low expression in fetal tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000100003, Expressed in liver and 167 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O76054, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O76054, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000100003, Tissue enhanced (epididymis, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117085, 4 interactors

Protein interaction database and analysis system

More...IntActi		O76054, 2 interactors

Molecular INTeraction database

More...MINTi		O76054

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000478755

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O76054, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1403
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O76054

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O76054

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini76 – 249CRAL-TRIOPROSITE-ProRule annotationAdd BLAST174
Domaini275 – 383GOLDPROSITE-ProRule annotationAdd BLAST109

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1471, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160650

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_014001_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O76054

Identification of Orthologs from Complete Genome Data

More...OMAi		GLCHCEG

Database for complete collections of gene phylogenies

More...PhylomeDBi		O76054

TreeFam database of animal gene trees

More...TreeFami		TF313988

Family and domain databases

Conserved Domains Database

More...CDDi		cd00170, SEC14, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.525.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001251, CRAL-TRIO_dom
IPR036865, CRAL-TRIO_dom_sf
IPR011074, CRAL/TRIO_N_dom
IPR036273, CRAL/TRIO_N_dom_sf
IPR009038, GOLD_dom
IPR036598, GOLD_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00650, CRAL_TRIO, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01100, CRAL_TRIO_N, 1 hit
SM00516, SEC14, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF101576, SSF101576, 1 hit
SSF46938, SSF46938, 1 hit
SSF52087, SSF52087, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50191, CRAL_TRIO, 1 hit
PS50866, GOLD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O76054-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGRVGDLSP RQKEALAKFR ENVQDVLPAL PNPDDYFLLR WLRARSFDLQ 
        60         70         80         90        100
KSEAMLRKHV EFRKQKDIDN IISWQPPEVI QQYLSGGMCG YDLDGCPVWY 
       110        120        130        140        150
DIIGPLDAKG LLFSASKQDL LRTKMRECEL LLQECAHQTT KLGRKVETIT 
       160        170        180        190        200
IIYDCEGLGL KHLWKPAVEA YGEFLCMFEE NYPETLKRLF VVKAPKLFPV 
       210        220        230        240        250
AYNLIKPFLS EDTRKKIMVL GANWKEVLLK HISPDQVPVE YGGTMTDPDG 
       260        270        280        290        300
NPKCKSKINY GGDIPRKYYV RDQVKQQYEH SVQISRGSSH QVEYEILFPG 
       310        320        330        340        350
CVLRWQFMSD GADVGFGIFL KTKMGERQRA GEMTEVLPNQ RYNSHLVPED 
       360        370        380        390        400
GTLTCSDPGI YVLRFDNTYS FIHAKKVNFT VEVLLPDKAS EEKMKQLGAG 

TPK
Length:403
Mass (Da):46,145
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD846747EC8D1513E
GO
Isoform 2 (identifier: O76054-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     361-403: YVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK → CKYLCLGNALKPHVQLSACEVPLPPWIFGSEC

Show »
Length:392
Mass (Da):44,748
Checksum:i11A833345968FE5A
GO
Isoform 3 (identifier: O76054-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-140: Missing.

Show »
Length:320
Mass (Da):36,636
Checksum:i64CCC92D4A8149C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JZI9C9JZI9_HUMAN
SEC14-like protein 2
SEC14L2
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3KRD8B3KRD8_HUMAN
SEC14-like 2 (S. cerevisiae), isofo...
SEC14L2 hCG_41297
329Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WED8F8WED8_HUMAN
SEC14-like protein 2
SEC14L2
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTM4C9JTM4_HUMAN
SEC14-like protein 2
SEC14L2
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEE7F8WEE7_HUMAN
SEC14-like protein 2
SEC14L2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JYY7C9JYY7_HUMAN
SEC14-like protein 2
SEC14L2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86500 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti36Y → H (PubMed:11444841).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02462611R → K2 PublicationsCorresponds to variant dbSNP:rs757660Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04588058 – 140Missing in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_042021361 – 403YVLRF…AGTPK → CKYLCLGNALKPHVQLSACE VPLPPWIFGSEC in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL096881 mRNA Translation: CAB51405.1
AB033012 mRNA Translation: BAA86500.2 Different initiation.
CR456571 mRNA Translation: CAG30457.1
AK303751 mRNA Translation: BAH14037.1
AK223587 mRNA Translation: BAD97307.1
AC004832 Genomic DNA Translation: AAF19256.1
BC058915 mRNA Translation: AAH58915.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13876.1 [O76054-1]
CCDS46685.1 [O76054-4]
CCDS56228.1 [O76054-5]

Protein sequence database of the Protein Information Resource

More...PIRi		JC7708

NCBI Reference Sequences

More...RefSeqi		NP_001191133.1, NM_001204204.2 [O76054-5]
NP_036561.1, NM_012429.4 [O76054-1]
NP_203740.1, NM_033382.2 [O76054-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000402592; ENSP00000383882; ENSG00000100003 [O76054-5]
ENST00000405717; ENSP00000385186; ENSG00000100003 [O76054-4]
ENST00000615189; ENSP00000478755; ENSG00000100003

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23541

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23541

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000615189.5; ENSP00000478755.1; NM_012429.5; NP_036561.1

UCSC genome browser

More...UCSCi		uc003ahq.5, human [O76054-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL096881 mRNA Translation: CAB51405.1
AB033012 mRNA Translation: BAA86500.2 Different initiation.
CR456571 mRNA Translation: CAG30457.1
AK303751 mRNA Translation: BAH14037.1
AK223587 mRNA Translation: BAD97307.1
AC004832 Genomic DNA Translation: AAF19256.1
BC058915 mRNA Translation: AAH58915.1
CCDSiCCDS13876.1 [O76054-1]
CCDS46685.1 [O76054-4]
CCDS56228.1 [O76054-5]
PIRiJC7708
RefSeqiNP_001191133.1, NM_001204204.2 [O76054-5]
NP_036561.1, NM_012429.4 [O76054-1]
NP_203740.1, NM_033382.2 [O76054-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1O6UX-ray2.05A/C/E1-403[»]
1OLMX-ray1.95A/C/E1-403[»]
4OMJX-ray1.60A/B1-275[»]
4OMKX-ray1.75A/B1-275[»]
SMRiO76054
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117085, 4 interactors
IntActiO76054, 2 interactors
MINTiO76054
STRINGi9606.ENSP00000478755

Chemistry databases

DrugBankiDB14003, alpha-Tocopherol acetate
DB14001, alpha-Tocopherol succinate
DB14002, D-alpha-Tocopherol acetate
DB11635, Tocofersolan
DB11251, Tocopherol
DB00163, Vitamin E

PTM databases

iPTMnetiO76054
MetOSiteiO76054
PhosphoSitePlusiO76054
SwissPalmiO76054

Genetic variation databases

BioMutaiSEC14L2

Proteomic databases

EPDiO76054
jPOSTiO76054
MassIVEiO76054
MaxQBiO76054
PaxDbiO76054
PeptideAtlasiO76054
PRIDEiO76054
ProteomicsDBi26377
50365 [O76054-1]
50366 [O76054-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		10725, 266 antibodies from 24 providers

The DNASU plasmid repository

More...DNASUi		23541

Genome annotation databases

EnsembliENST00000402592; ENSP00000383882; ENSG00000100003 [O76054-5]
ENST00000405717; ENSP00000385186; ENSG00000100003 [O76054-4]
ENST00000615189; ENSP00000478755; ENSG00000100003
GeneIDi23541
KEGGihsa:23541
MANE-SelectiENST00000615189.5; ENSP00000478755.1; NM_012429.5; NP_036561.1
UCSCiuc003ahq.5, human [O76054-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23541
DisGeNETi23541

GeneCards: human genes, protein and diseases

More...GeneCardsi		SEC14L2
HGNCiHGNC:10699, SEC14L2
HPAiENSG00000100003, Tissue enhanced (epididymis, liver)
MIMi607558, gene
neXtProtiNX_O76054
OpenTargetsiENSG00000100003
PharmGKBiPA35622
VEuPathDBiHostDB:ENSG00000100003

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...
Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1471, Eukaryota
GeneTreeiENSGT00940000160650
HOGENOMiCLU_014001_2_1_1
InParanoidiO76054
OMAiGLCHCEG
PhylomeDBiO76054
TreeFamiTF313988

Enzyme and pathway databases

PathwayCommonsiO76054
SignaLinkiO76054

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23541, 11 hits in 1042 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SEC14L2, human
EvolutionaryTraceiO76054

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SEC14L2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23541
PharosiO76054, Tbio

Protein Ontology

More...PROi		PR:O76054
RNActiO76054, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000100003, Expressed in liver and 167 other tissues
ExpressionAtlasiO76054, baseline and differential
GenevisibleiO76054, HS

Family and domain databases

CDDicd00170, SEC14, 1 hit
Gene3Di3.40.525.10, 1 hit
InterProiView protein in InterPro
IPR001251, CRAL-TRIO_dom
IPR036865, CRAL-TRIO_dom_sf
IPR011074, CRAL/TRIO_N_dom
IPR036273, CRAL/TRIO_N_dom_sf
IPR009038, GOLD_dom
IPR036598, GOLD_dom_sf
PfamiView protein in Pfam
PF00650, CRAL_TRIO, 1 hit
SMARTiView protein in SMART
SM01100, CRAL_TRIO_N, 1 hit
SM00516, SEC14, 1 hit
SUPFAMiSSF101576, SSF101576, 1 hit
SSF46938, SSF46938, 1 hit
SSF52087, SSF52087, 1 hit
PROSITEiView protein in PROSITE
PS50191, CRAL_TRIO, 1 hit
PS50866, GOLD, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS14L2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O76054
Secondary accession number(s): B7Z8Q1
, F5H3U4, Q53EQ2, Q6PD61, Q9ULN4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2002
Last sequence update: November 1, 1998
Last modified: February 23, 2022
This is version 187 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again