Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Keratin, type I cuticular Ha6

Gene

KRT36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Miscellaneous

There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei342Stutter1

GO - Molecular functioni

  • structural constituent of epidermis Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-6805567 Keratinization
R-HSA-6809371 Formation of the cornified envelope

Names & Taxonomyi

Protein namesi
Recommended name:
Keratin, type I cuticular Ha6
Alternative name(s):
Hair keratin, type I Ha6
Keratin-36
Short name:
K36
Gene namesi
Name:KRT36
Synonyms:HHA6, HKA6, KRTHA6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000126337.13
HGNCiHGNC:6454 KRT36
MIMi604540 gene
neXtProtiNX_O76013

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Intermediate filament, Keratin

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000126337
PharmGKBiPA30243

Polymorphism and mutation databases

BioMutaiKRT36

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000636931 – 467Keratin, type I cuticular Ha6Add BLAST467

Proteomic databases

PaxDbiO76013
PeptideAtlasiO76013
PRIDEiO76013
ProteomicsDBi12650
50344
50345 [O76013-2]

PTM databases

CarbonylDBiO76013
iPTMnetiO76013
PhosphoSitePlusiO76013

Expressioni

Tissue specificityi

Expressed in the hair follicles.1 Publication

Gene expression databases

BgeeiENSG00000126337 Expressed in 26 organ(s), highest expression level in tongue
CleanExiHS_KRT36
GenevisibleiO76013 HS

Interactioni

Subunit structurei

Heterotetramer of two type I and two type II keratins.By similarity

Protein-protein interaction databases

BioGridi114236, 10 interactors
IntActiO76013, 63 interactors
STRINGi9606.ENSP00000329165

Structurei

3D structure databases

ProteinModelPortaliO76013
SMRiO76013
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini93 – 404IF rodPROSITE-ProRule annotationAdd BLAST312

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 93HeadAdd BLAST93
Regioni94 – 128Coil 1AAdd BLAST35
Regioni129 – 139Linker 1Add BLAST11
Regioni140 – 240Coil 1BAdd BLAST101
Regioni241 – 256Linker 12Add BLAST16
Regioni257 – 400Coil 2Add BLAST144
Regioni401 – 467TailAdd BLAST67

Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFTF Eukaryota
ENOG410Y9IV LUCA
GeneTreeiENSGT00900000140814
HOGENOMiHOG000230975
HOVERGENiHBG013015
InParanoidiO76013
KOiK07604
OMAiECKPAVR
OrthoDBiEOG091G087I
PhylomeDBiO76013
TreeFamiTF332742

Family and domain databases

InterProiView protein in InterPro
IPR001664 IF
IPR018039 IF_conserved
IPR039008 IF_rod_dom
IPR002957 Keratin_I
PANTHERiPTHR23239 PTHR23239, 1 hit
PfamiView protein in Pfam
PF00038 Filament, 1 hit
PRINTSiPR01248 TYPE1KERATIN
SMARTiView protein in SMART
SM01391 Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226 IF_ROD_1, 1 hit
PS51842 IF_ROD_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O76013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS
60 70 80 90 100
SARSGLSGLG SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL
110 120 130 140 150
NDRLANYLEK VRQLERENAE LESRIQEWYE FQIPYICPDY QSYFKTIEDF
160 170 180 190 200
QQKILLTKSE NARLVLQIDN AKLAADDFRT KYETELSLRQ LVEADINGLR
210 220 230 240 250
RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC QLGDRLNVEV
260 270 280 290 300
DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE
310 320 330 340 350
QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ
360 370 380 390 400
MQCLISNVEA QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE
410 420 430 440 450
DCKLPPQPCA TACKPVIRVP SVPPVPCVPS VPCTPAPQVG TQIRTITEEI
460
RDGKVISSRE HVQSRPL
Length:467
Mass (Da):52,247
Last modified:November 1, 1998 - v1
Checksum:i492B3B2DE3BCAECD
GO
Isoform 2 (identifier: O76013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):47,485
Checksum:iD27B5052EDC12A3B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024490119A → V. Corresponds to variant dbSNP:rs8082683Ensembl.1
Natural variantiVAR_024491126Q → R. Corresponds to variant dbSNP:rs8069943Ensembl.1
Natural variantiVAR_049792179R → Q. Corresponds to variant dbSNP:rs9675246Ensembl.1
Natural variantiVAR_049793277R → C. Corresponds to variant dbSNP:rs9904102Ensembl.1
Natural variantiVAR_020306315T → M. Corresponds to variant dbSNP:rs2301354Ensembl.1
Natural variantiVAR_049794357N → T. Corresponds to variant dbSNP:rs11657323Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0364031 – 52MATQT…YISSA → ML in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA Translation: CAA76388.1
CH471152 Genomic DNA Translation: EAW60738.1
BC043581 mRNA Translation: AAH43581.1
CCDSiCCDS11395.1 [O76013-1]
RefSeqiNP_003762.1, NM_003771.4 [O76013-1]
UniGeneiHs.248189

Genome annotation databases

EnsembliENST00000328119; ENSP00000329165; ENSG00000126337 [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337 [O76013-2]
GeneIDi8689
KEGGihsa:8689
UCSCiuc002hwt.3 human [O76013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA Translation: CAA76388.1
CH471152 Genomic DNA Translation: EAW60738.1
BC043581 mRNA Translation: AAH43581.1
CCDSiCCDS11395.1 [O76013-1]
RefSeqiNP_003762.1, NM_003771.4 [O76013-1]
UniGeneiHs.248189

3D structure databases

ProteinModelPortaliO76013
SMRiO76013
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114236, 10 interactors
IntActiO76013, 63 interactors
STRINGi9606.ENSP00000329165

PTM databases

CarbonylDBiO76013
iPTMnetiO76013
PhosphoSitePlusiO76013

Polymorphism and mutation databases

BioMutaiKRT36

Proteomic databases

PaxDbiO76013
PeptideAtlasiO76013
PRIDEiO76013
ProteomicsDBi12650
50344
50345 [O76013-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328119; ENSP00000329165; ENSG00000126337 [O76013-1]
ENST00000393986; ENSP00000377555; ENSG00000126337 [O76013-2]
GeneIDi8689
KEGGihsa:8689
UCSCiuc002hwt.3 human [O76013-1]

Organism-specific databases

CTDi8689
EuPathDBiHostDB:ENSG00000126337.13
GeneCardsiKRT36
H-InvDBiHIX0027332
HGNCiHGNC:6454 KRT36
MIMi604540 gene
neXtProtiNX_O76013
OpenTargetsiENSG00000126337
PharmGKBiPA30243
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFTF Eukaryota
ENOG410Y9IV LUCA
GeneTreeiENSGT00900000140814
HOGENOMiHOG000230975
HOVERGENiHBG013015
InParanoidiO76013
KOiK07604
OMAiECKPAVR
OrthoDBiEOG091G087I
PhylomeDBiO76013
TreeFamiTF332742

Enzyme and pathway databases

ReactomeiR-HSA-6805567 Keratinization
R-HSA-6809371 Formation of the cornified envelope

Miscellaneous databases

GeneWikiiKRT36
GenomeRNAii8689
PROiPR:O76013
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126337 Expressed in 26 organ(s), highest expression level in tongue
CleanExiHS_KRT36
GenevisibleiO76013 HS

Family and domain databases

InterProiView protein in InterPro
IPR001664 IF
IPR018039 IF_conserved
IPR039008 IF_rod_dom
IPR002957 Keratin_I
PANTHERiPTHR23239 PTHR23239, 1 hit
PfamiView protein in Pfam
PF00038 Filament, 1 hit
PRINTSiPR01248 TYPE1KERATIN
SMARTiView protein in SMART
SM01391 Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226 IF_ROD_1, 1 hit
PS51842 IF_ROD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKRT36_HUMAN
AccessioniPrimary (citable) accession number: O76013
Secondary accession number(s): Q86XG4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: November 7, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again