Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website on Tuesday, June 28. Please explore and share your feedback. Take me to UniProt BETA

UniProtKB - O76013 (KRT36_HUMAN)

Entry version 170 (25 May 2022)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Keratin, type I cuticular Ha6

Gene

KRT36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei342Stutter1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O76013

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6805567, Keratinization
R-HSA-6809371, Formation of the cornified envelope

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O76013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Keratin, type I cuticular Ha6
Alternative name(s):
Hair keratin, type I Ha6
Keratin-36
Short name:
K36
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KRT36
Synonyms:HHA6, HKA6, KRTHA6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6454, KRT36

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604540, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O76013

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000126337

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Intermediate filament, Keratin

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8689

Open Targets

More...OpenTargetsi		ENSG00000126337

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30243

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O76013, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KRT36

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000636931 – 467Keratin, type I cuticular Ha6Add BLAST467

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O76013

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O76013

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O76013

PeptideAtlas

More...PeptideAtlasi		O76013

PRoteomics IDEntifications database

More...PRIDEi		O76013

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		50344 [O76013-1]
50345 [O76013-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		O76013

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O76013

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O76013

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the hair follicles.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000126337, Expressed in tongue and 40 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O76013, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000126337, Group enriched (lymphoid tissue, skin)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer of two type I and two type II keratins.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Isoform 2 [O76013-2]
With#Exp.IntAct
ABI2 - isoform 2 [Q9NYB9-2]3EBI-11958506,EBI-11096309
ABI3 [Q9P2A4]3EBI-11958506,EBI-742038
AIMP2 [Q13155]3EBI-11958506,EBI-745226
AMOT [A2BDD9]3EBI-11958506,EBI-17286414
BCAS2 [O75934]3EBI-11958506,EBI-1050106
C1orf216 [Q8TAB5]3EBI-11958506,EBI-747505
CCBE1 - isoform 3 [Q6UXH8-3]3EBI-11958506,EBI-12013534
CCHCR1 - isoform 3 [Q8TD31-3]3EBI-11958506,EBI-10175300
CDC23 [Q9UJX2]3EBI-11958506,EBI-396137
DMRT3 [Q9NQL9]3EBI-11958506,EBI-9679045
EXOC8 [Q8IYI6]4EBI-11958506,EBI-742102
GEM [P55040]3EBI-11958506,EBI-744104
GPS2 [Q13227]3EBI-11958506,EBI-713355
HCK - isoform 2 [P08631-2]3EBI-11958506,EBI-9834454
HGS [O14964]3EBI-11958506,EBI-740220
HOXC8 [P31273]3EBI-11958506,EBI-1752118
KRT1 [P04264]3EBI-11958506,EBI-298429
KRT2 [P35908]3EBI-11958506,EBI-1247312
KRT3 [P12035]5EBI-11958506,EBI-2430095
KRT4 [P19013]5EBI-11958506,EBI-2371606
KRT6A [P02538]3EBI-11958506,EBI-702198
KRT6C [P48668]3EBI-11958506,EBI-2564105
KRT73 - isoform 2 [Q86Y46-2]3EBI-11958506,EBI-12039441
KRT75 [O95678]5EBI-11958506,EBI-2949715
KRT76 [Q01546]3EBI-11958506,EBI-2952745
KRT77 [Q7Z794]3EBI-11958506,EBI-3045529
KRT78 [Q8N1N4]3EBI-11958506,EBI-1056564
KRT79 [Q5XKE5]3EBI-11958506,EBI-2514135
KRT8 [P05787]3EBI-11958506,EBI-297852
KRT80 - isoform 2 [Q6KB66-2]3EBI-11958506,EBI-11999246
KRT85 [P78386]3EBI-11958506,EBI-1049371
KRT86 [O43790]5EBI-11958506,EBI-9996498
MYOZ1 [Q9NP98]3EBI-11958506,EBI-744402
MYOZ3 [Q8TDC0]3EBI-11958506,EBI-5662487
PKN1 [Q16512]3EBI-11958506,EBI-602382
PLEKHN1 - isoform 3 [Q494U1-3]3EBI-11958506,EBI-12014286
PPP1R18 [Q6NYC8]3EBI-11958506,EBI-2557469
PSMB1 [P20618]3EBI-11958506,EBI-372273
QARS1 [P47897]3EBI-11958506,EBI-347462
RESF1 [Q9HCM1]3EBI-11958506,EBI-308368
RIBC1 [Q8N443]3EBI-11958506,EBI-10265323
TMSB4X [P62328]3EBI-11958506,EBI-712598
TRAF4 [Q9BUZ4]3EBI-11958506,EBI-3650647
TSGA10IP [Q3SY00]3EBI-11958506,EBI-10241197
TTC23 - isoform 3 [Q5W5X9-3]3EBI-11958506,EBI-9090990
TTLL10 - isoform 3 [Q6ZVT0-3]3EBI-11958506,EBI-11979997
TXLNA [P40222]3EBI-11958506,EBI-359793
ZNF414 [Q96IQ9]3EBI-11958506,EBI-744257
ZNF785 [A8K8V0]3EBI-11958506,EBI-3925400

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114236, 61 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-5663, Keratin-36 - Keratin-86 dimer complex

Protein interaction database and analysis system

More...IntActi		O76013, 63 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000329165

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O76013, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		O76013

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O76013

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini93 – 404IF rodPROSITE-ProRule annotationAdd BLAST312

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 93HeadAdd BLAST93
Regioni94 – 128Coil 1AAdd BLAST35
Regioni129 – 139Linker 1Add BLAST11
Regioni140 – 240Coil 1BAdd BLAST101
Regioni241 – 256Linker 12Add BLAST16
Regioni257 – 400Coil 2Add BLAST144
Regioni401 – 467TailAdd BLAST67

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QQY9, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161311

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012560_8_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O76013

Identification of Orthologs from Complete Genome Data

More...OMAi		AHPCSTE

Database of Orthologous Groups

More...OrthoDBi		798081at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O76013

TreeFam database of animal gene trees

More...TreeFami		TF332742

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR002957, Keratin_I

The PANTHER Classification System

More...PANTHERi		PTHR23239, PTHR23239, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00038, Filament, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01248, TYPE1KERATIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01391, Filament, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O76013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATQTCTPTF STGSIKGLCG TAGGISRVSS IRSVGSCRVP SLAGAAGYIS 
        60         70         80         90        100
SARSGLSGLG SCLPGSYLSS ECHTSGFVGS GGWFCEGSFN GSEKETMQFL 
       110        120        130        140        150
NDRLANYLEK VRQLERENAE LESRIQEWYE FQIPYICPDY QSYFKTIEDF 
       160        170        180        190        200
QQKILLTKSE NARLVLQIDN AKLAADDFRT KYETELSLRQ LVEADINGLR 
       210        220        230        240        250
RILDELTLCK ADLEAQVESL KEELMCLKKN HEEEVSVLRC QLGDRLNVEV 
       260        270        280        290        300
DAAPPVDLNK ILEDMRCQYE ALVENNRRDV EAWFNTQTEE LNQQVVSSSE 
       310        320        330        340        350
QLQCCQTEII ELRRTVNALE IELQAQHSMR NSLESTLAET EARYSSQLAQ 
       360        370        380        390        400
MQCLISNVEA QLSEIRCDLE RQNQEYQVLL DVKARLEGEI ATYRHLLEGE 
       410        420        430        440        450
DCKLPPQPCA TACKPVIRVP SVPPVPCVPS VPCTPAPQVG TQIRTITEEI 
       460 
RDGKVISSRE HVQSRPL
Length:467
Mass (Da):52,247
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i492B3B2DE3BCAECD
GO
Isoform 2 (identifier: O76013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSA → ML

Show »
Length:417
Mass (Da):47,485
Checksum:iD27B5052EDC12A3B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024490119A → V. Corresponds to variant dbSNP:rs8082683EnsemblClinVar.1
Natural variantiVAR_024491126Q → R. Corresponds to variant dbSNP:rs8069943EnsemblClinVar.1
Natural variantiVAR_049792179R → Q. Corresponds to variant dbSNP:rs9675246Ensembl.1
Natural variantiVAR_049793277R → C. Corresponds to variant dbSNP:rs9904102Ensembl.1
Natural variantiVAR_020306315T → M. Corresponds to variant dbSNP:rs2301354Ensembl.1
Natural variantiVAR_049794357N → T. Corresponds to variant dbSNP:rs11657323Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364031 – 52MATQT…YISSA → ML in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y16792 Genomic DNA Translation: CAA76388.1
CH471152 Genomic DNA Translation: EAW60738.1
BC043581 mRNA Translation: AAH43581.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11395.1 [O76013-1]

NCBI Reference Sequences

More...RefSeqi		NP_003762.1, NM_003771.4 [O76013-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000328119.11; ENSP00000329165.6; ENSG00000126337.14
ENST00000393986.2; ENSP00000377555.2; ENSG00000126337.14 [O76013-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8689

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8689

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000328119.11; ENSP00000329165.6; NM_003771.5; NP_003762.1

UCSC genome browser

More...UCSCi		uc002hwt.3, human [O76013-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16792 Genomic DNA Translation: CAA76388.1
CH471152 Genomic DNA Translation: EAW60738.1
BC043581 mRNA Translation: AAH43581.1
CCDSiCCDS11395.1 [O76013-1]
RefSeqiNP_003762.1, NM_003771.4 [O76013-1]

3D structure databases

AlphaFoldDBiO76013
SMRiO76013
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114236, 61 interactors
ComplexPortaliCPX-5663, Keratin-36 - Keratin-86 dimer complex
IntActiO76013, 63 interactors
STRINGi9606.ENSP00000329165

PTM databases

CarbonylDBiO76013
iPTMnetiO76013
PhosphoSitePlusiO76013

Genetic variation databases

BioMutaiKRT36

Proteomic databases

jPOSTiO76013
MassIVEiO76013
PaxDbiO76013
PeptideAtlasiO76013
PRIDEiO76013
ProteomicsDBi50344 [O76013-1]
50345 [O76013-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16678, 138 antibodies from 26 providers

The DNASU plasmid repository

More...DNASUi		8689

Genome annotation databases

EnsembliENST00000328119.11; ENSP00000329165.6; ENSG00000126337.14
ENST00000393986.2; ENSP00000377555.2; ENSG00000126337.14 [O76013-2]
GeneIDi8689
KEGGihsa:8689
MANE-SelectiENST00000328119.11; ENSP00000329165.6; NM_003771.5; NP_003762.1
UCSCiuc002hwt.3, human [O76013-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8689
DisGeNETi8689

GeneCards: human genes, protein and diseases

More...GeneCardsi		KRT36
HGNCiHGNC:6454, KRT36
HPAiENSG00000126337, Group enriched (lymphoid tissue, skin)
MIMi604540, gene
neXtProtiNX_O76013
OpenTargetsiENSG00000126337
PharmGKBiPA30243
VEuPathDBiHostDB:ENSG00000126337

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QQY9, Eukaryota
GeneTreeiENSGT00940000161311
HOGENOMiCLU_012560_8_0_1
InParanoidiO76013
OMAiAHPCSTE
OrthoDBi798081at2759
PhylomeDBiO76013
TreeFamiTF332742

Enzyme and pathway databases

PathwayCommonsiO76013
ReactomeiR-HSA-6805567, Keratinization
R-HSA-6809371, Formation of the cornified envelope
SignaLinkiO76013

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8689, 9 hits in 1064 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KRT36

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8689
PharosiO76013, Tdark

Protein Ontology

More...PROi		PR:O76013
RNActiO76013, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000126337, Expressed in tongue and 40 other tissues
GenevisibleiO76013, HS

Family and domain databases

InterProiView protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR002957, Keratin_I
PANTHERiPTHR23239, PTHR23239, 1 hit
PfamiView protein in Pfam
PF00038, Filament, 1 hit
PRINTSiPR01248, TYPE1KERATIN
SMARTiView protein in SMART
SM01391, Filament, 1 hit
PROSITEiView protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKRT36_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O76013
Secondary accession number(s): Q86XG4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: May 25, 2022
This is version 170 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again