UniProtKB - O76001 (OR2J3_HUMAN)

BLAST

>sp|O76001|OR2J3_HUMAN Olfactory receptor 2J3 OS=Homo sapiens OX=9606 GN=OR2J3 PE=1 SV=1
MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHT
PMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVV
MSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHF
FCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVRAVLRMQSTTGLQKV
FGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVV
RGAVKRLMGWE

Align
Format
Add to basket Added to basket
History
Entry version 161 (07 Nov 2018)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Olfactory receptor 2J3

Gene

OR2J3

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Odorant receptor involved in the detection of the flavor compound cis-3-hexen-1-ol (C3HEX), a compound typically described as 'green grassy' or the smell of 'cut grass'.1 Publication

GO - Molecular functionⁱ

G protein-coupled receptor activity Source: UniProtKB-KW
olfactory receptor activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	G-protein coupled receptor, Receptor, Transducer
Biological process	Olfaction, Sensory transduction

Enzyme and pathway databases

Reactomeⁱ	R-HSA-381753 Olfactory Signaling Pathway

Reactomeⁱ

R-HSA-381753 Olfactory Signaling Pathway

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Olfactory receptor 2J3 Alternative name(s): Hs6M1-3 Olfactory receptor OR6-16 Short name: OR6-6 Short name: Olfactory receptor 6-6
Gene namesⁱ	Name:OR2J3
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 6

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000204701.1
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:8261 OR2J3
MIMⁱ	615016 gene
neXtProtⁱ	NX_O76001

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 28	ExtracellularSequence analysisAdd BLAST	28
Transmembraneⁱ	29 – 52	Helical; Name=1Sequence analysisAdd BLAST	24
Topological domainⁱ	53 – 60	CytoplasmicSequence analysis	8
Transmembraneⁱ	61 – 82	Helical; Name=2Sequence analysisAdd BLAST	22
Topological domainⁱ	83 – 103	ExtracellularSequence analysisAdd BLAST	21
Transmembraneⁱ	104 – 123	Helical; Name=3Sequence analysisAdd BLAST	20
Topological domainⁱ	124 – 142	CytoplasmicSequence analysisAdd BLAST	19
Transmembraneⁱ	143 – 161	Helical; Name=4Sequence analysisAdd BLAST	19
Topological domainⁱ	162 – 198	ExtracellularSequence analysisAdd BLAST	37
Transmembraneⁱ	199 – 222	Helical; Name=5Sequence analysisAdd BLAST	24
Topological domainⁱ	223 – 239	CytoplasmicSequence analysisAdd BLAST	17
Transmembraneⁱ	240 – 262	Helical; Name=6Sequence analysisAdd BLAST	23
Topological domainⁱ	263 – 275	ExtracellularSequence analysisAdd BLAST	13
Transmembraneⁱ	276 – 295	Helical; Name=7Sequence analysisAdd BLAST	20
Topological domainⁱ	296 – 311	CytoplasmicSequence analysisAdd BLAST	16

Keywords - Cellular componentⁱ

Cell membrane, Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	442186
MalaCards human disease database More...MalaCardsⁱ	OR2J3
MIMⁱ	615082 phenotype
PharmGKBⁱ	PA32178

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000150484	1 – 311	Olfactory receptor 2J3Add BLAST		311

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Glycosylationⁱ	8	N-linked (GlcNAc...) asparagineSequence analysis		1
Disulfide bondⁱ	100 ↔ 192	PROSITE-ProRule annotation

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

EPDⁱ	O76001
PaxDbⁱ	O76001
PeptideAtlas More...PeptideAtlasⁱ	O76001
PRIDEⁱ	O76001
ProteomicsDBⁱ	50339

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000204701 Expressed in 5 organ(s), highest expression level in testis
CleanExⁱ	HS_OR2J3
ExpressionAtlasⁱ	O76001 baseline and differential
Genevisibleⁱ	O76001 HS

Interactionⁱ

Protein-protein interaction databases

STRINGⁱ	9606.ENSP00000366374

STRINGⁱ

9606.ENSP00000366374

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O76001
SMRⁱ	O76001
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410JAWR Eukaryota ENOG4111DPD LUCA
HOVERGENⁱ	HBG017625
InParanoidⁱ	O76001
KEGG Orthology (KO) More...KOⁱ	K04257
Database of Orthologous Groups More...OrthoDBⁱ	EOG09370HYW
PhylomeDBⁱ	O76001
TreeFamⁱ	TF336512

Family and domain databases

InterProⁱ	View protein in InterPro IPR000276 GPCR_Rhodpsn IPR017452 GPCR_Rhodpsn_7TM IPR000725 Olfact_rcpt
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF13853 7tm_4, 1 hit
PRINTSⁱ	PR00237 GPCRRHODOPSN PR00245 OLFACTORYR
PROSITEⁱ	View protein in PROSITE PS00237 G_PROTEIN_RECEP_F1_1, 1 hit PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

O76001-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MNDDGKVNAS SEGYFILVGF SNWPHLEVVI FVVVLIFYLM TLIGNLFIII 
        60         70         80         90        100
LSYLDSHLHT PMYFFLSNLS FLDLCYTTSS IPQLLVNLWG PEKTISYAGC 
       110        120        130        140        150
MIQLYFVLAL GTTECVLLVV MSYDRYAAVC RPLHYTVLMH PRFCHLLAVA 
       160        170        180        190        200
SWVSGFTNSA LHSSFTFWVP LCGHRQVDHF FCEVPALLRL SCVDTHVNEL 
       210        220        230        240        250
TLMITSSIFV LIPLILILTS YGAIVRAVLR MQSTTGLQKV FGTCGAHLMA 
       260        270        280        290        300
VSLFFIPAMC IYLQPPSGNS QDQGKFIALF YTVVTPSLNP LIYTLRNKVV 
       310 
RGAVKRLMGW E

Length:311

Mass (Da):34,950

Last modified:November 1, 1998 - v1

Checksum:ⁱ84201145B9D5AA68

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A126GWT2	A0A126GWT2_HUMAN	Olfactory receptor Olfactory receptor	OR2J3	311	Annotation score:
A0A140T964	A0A140T964_HUMAN	Olfactory receptor Olfactory receptor	OR2J3	258	Annotation score:

Polymorphismⁱ

Variants Ala-113 and Gln-226 exhibit a reduced ability to smell C3HEX [MIMⁱ:615082]. When both variants are present in the same haplotype (allele 6M1-3*02), the response to C3HEX is abolished. African populations have a higher proportion of the C3HEX-nonresponsive haplotype than other populations. All haplotypes containing Gln-226 show low levels of surface expression.1 Publication

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_010949	113	T → A in allele 6M1-3*02; decreased response to C3HEX. 2 PublicationsCorresponds to variant dbSNP:rs28757581EnsemblClinVar.	1
Natural variantⁱVAR_010950	226	R → Q in allele 6M1-3*02; decreased response to C3HEX. 2 PublicationsCorresponds to variant dbSNP:rs3749977EnsemblClinVar.	1
Natural variantⁱVAR_010951	228	V → I in allele 6M1-3*03. 1 PublicationCorresponds to variant dbSNP:rs3130764Ensembl.	1
Natural variantⁱVAR_010952	261	I → M in allele 6M1-303 and allele 6M1-304. 3 PublicationsCorresponds to variant dbSNP:rs3130765Ensembl.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ302547 Genomic DNA Translation: CAC20472.1 AJ302548 Genomic DNA Translation: CAC20473.1 AJ302549 Genomic DNA Translation: CAC20474.1 AJ302550 Genomic DNA Translation: CAC20475.1 AJ302551 Genomic DNA Translation: CAC20476.1 AJ302552 Genomic DNA Translation: CAC21440.1 AJ302553 Genomic DNA Translation: CAC21441.1 AJ302554 Genomic DNA Translation: CAC21442.1 AJ302555 Genomic DNA Translation: CAC21443.1 AJ302556 Genomic DNA Translation: CAC21444.1 AJ302557 Genomic DNA Translation: CAC20477.1 AJ302558 Genomic DNA Translation: CAC20478.1 AL645937 Genomic DNA No translation available. AL022727 Genomic DNA Translation: CAA18783.1 AL662852 Genomic DNA No translation available. AL929561 Genomic DNA No translation available. BX248093 Genomic DNA No translation available. CR547123 Genomic DNA No translation available. CR388415 Genomic DNA No translation available. CR942175 Genomic DNA No translation available. BC136973 mRNA Translation: AAI36974.1 BC136975 mRNA Translation: AAI36976.1 AF399630 Genomic DNA Translation: AAK95115.1 BK004437 Genomic DNA Translation: DAA04835.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS43433.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001005216.2, NM_001005216.3
UniGeneⁱ	Hs.738947

Genome annotation databases

Ensemblⁱ	ENST00000377169; ENSP00000366374; ENSG00000204701 ENST00000383651; ENSP00000373147; ENSG00000206522 ENST00000414140; ENSP00000390144; ENSG00000232178 ENST00000418630; ENSP00000400546; ENSG00000233618 ENST00000419260; ENSP00000408783; ENSG00000229866 ENST00000428081; ENSP00000388392; ENSG00000226271 ENST00000430478; ENSP00000388205; ENSG00000233636
GeneIDⁱ	442186
KEGGⁱ	hsa:442186
UCSC genome browser More...UCSCⁱ	uc011dll.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O76001	Olfactory receptor		HUMAN		311	UniRef100_O76001

Protein	Similar proteins		Species	Score	Length	Source
O76001	Olfactory receptor 2J1		HUMAN		312	UniRef90_O76001
Olfactory receptor		PANPA		317
Olfactory receptor		MANLE		313
Olfactory receptor		GORGO		312
Olfactory receptor		PANTR		312
+70

Protein	Similar proteins		Species	Score	Length	Source
O76001	Olfactory receptor 2J2		HUMAN		312	UniRef50_O76001
Olfactory receptor		PANPA		317
Olfactory receptor		MANLE		313
Olfactory receptor		RHIRO		312
Olfactory receptor		PONAB		312
+185

Cross-referencesⁱ

Web resourcesⁱ

Human Olfactory Receptor Data Exploratorium (HORDE)

Protein Spotlight

The intricacy of a smell - Issue 150 of July 2013

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ302547 Genomic DNA Translation: CAC20472.1 AJ302548 Genomic DNA Translation: CAC20473.1 AJ302549 Genomic DNA Translation: CAC20474.1 AJ302550 Genomic DNA Translation: CAC20475.1 AJ302551 Genomic DNA Translation: CAC20476.1 AJ302552 Genomic DNA Translation: CAC21440.1 AJ302553 Genomic DNA Translation: CAC21441.1 AJ302554 Genomic DNA Translation: CAC21442.1 AJ302555 Genomic DNA Translation: CAC21443.1 AJ302556 Genomic DNA Translation: CAC21444.1 AJ302557 Genomic DNA Translation: CAC20477.1 AJ302558 Genomic DNA Translation: CAC20478.1 AL645937 Genomic DNA No translation available. AL022727 Genomic DNA Translation: CAA18783.1 AL662852 Genomic DNA No translation available. AL929561 Genomic DNA No translation available. BX248093 Genomic DNA No translation available. CR547123 Genomic DNA No translation available. CR388415 Genomic DNA No translation available. CR942175 Genomic DNA No translation available. BC136973 mRNA Translation: AAI36974.1 BC136975 mRNA Translation: AAI36976.1 AF399630 Genomic DNA Translation: AAK95115.1 BK004437 Genomic DNA Translation: DAA04835.1
CCDSⁱ	CCDS43433.1
RefSeqⁱ	NP_001005216.2, NM_001005216.3
UniGeneⁱ	Hs.738947

3D structure databases

ProteinModelPortalⁱ	O76001
SMRⁱ	O76001
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	9606.ENSP00000366374

STRINGⁱ

9606.ENSP00000366374

Protein family/group databases

GPCRDBⁱ	Search...

GPCRDBⁱ

Search...

Proteomic databases

EPDⁱ	O76001
PaxDbⁱ	O76001
PeptideAtlasⁱ	O76001
PRIDEⁱ	O76001
ProteomicsDBⁱ	50339

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000377169; ENSP00000366374; ENSG00000204701 ENST00000383651; ENSP00000373147; ENSG00000206522 ENST00000414140; ENSP00000390144; ENSG00000232178 ENST00000418630; ENSP00000400546; ENSG00000233618 ENST00000419260; ENSP00000408783; ENSG00000229866 ENST00000428081; ENSP00000388392; ENSG00000226271 ENST00000430478; ENSP00000388205; ENSG00000233636
GeneIDⁱ	442186
KEGGⁱ	hsa:442186
UCSCⁱ	uc011dll.4 human

Organism-specific databases

CTDⁱ	442186
DisGeNETⁱ	442186
EuPathDBⁱ	HostDB:ENSG00000204701.1
GeneCardsⁱ	OR2J3
H-InvDBⁱ	HIX0165965 HIX0166175 HIX0201061 HIX0201063 HIX0201071 HIX0201073 HIX0201086 HIX0201090 HIX0201106 HIX0201108
HGNCⁱ	HGNC:8261 OR2J3
MalaCardsⁱ	OR2J3
MIMⁱ	615016 gene 615082 phenotype
neXtProtⁱ	NX_O76001
PharmGKBⁱ	PA32178
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410JAWR Eukaryota ENOG4111DPD LUCA
HOVERGENⁱ	HBG017625
InParanoidⁱ	O76001
KOⁱ	K04257
OrthoDBⁱ	EOG09370HYW
PhylomeDBⁱ	O76001
TreeFamⁱ	TF336512

Enzyme and pathway databases

Reactomeⁱ	R-HSA-381753 Olfactory Signaling Pathway

Reactomeⁱ

R-HSA-381753 Olfactory Signaling Pathway

Miscellaneous databases

GeneWikiⁱ	OR2J3
GenomeRNAiⁱ	442186
Protein Ontology More...PROⁱ	PR:O76001
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000204701 Expressed in 5 organ(s), highest expression level in testis
CleanExⁱ	HS_OR2J3
ExpressionAtlasⁱ	O76001 baseline and differential
Genevisibleⁱ	O76001 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR000276 GPCR_Rhodpsn IPR017452 GPCR_Rhodpsn_7TM IPR000725 Olfact_rcpt
Pfamⁱ	View protein in Pfam PF13853 7tm_4, 1 hit
PRINTSⁱ	PR00237 GPCRRHODOPSN PR00245 OLFACTORYR
PROSITEⁱ	View protein in PROSITE PS00237 G_PROTEIN_RECEP_F1_1, 1 hit PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	OR2J3_HUMAN
Accessionⁱ	O76001Primary (citable) accession number: O76001 Secondary accession number(s): B0UY52 Q9GZL5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	June 20, 2001
	Last sequence update:	November 1, 1998
	Last modified:	November 7, 2018
	This is version 161 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 6
Human chromosome 6: entries, gene names and cross-references to MIM
7-transmembrane G-linked receptors
List of 7-transmembrane G-linked receptor entries
Protein Spotlight
Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O76001 (OR2J3_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Olfactory receptor 2J3

OR2J3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ