Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (22 Apr 2020)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DnaJ homolog subfamily B member 5

Gene

DNAJB5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DnaJ homolog subfamily B member 5
Alternative name(s):
Heat shock protein Hsp40-2
Heat shock protein Hsp40-3
Heat shock protein cognate 40
Short name:
Hsc40
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAJB5
Synonyms:HSC40
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14887 DNAJB5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611328 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75953

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25822

Open Targets

More...
OpenTargetsi
ENSG00000137094

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27417

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O75953 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAJB5

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000710231 – 348DnaJ homolog subfamily B member 5Add BLAST348

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75953

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75953

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O75953

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75953

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75953

PeptideAtlas

More...
PeptideAtlasi
O75953

PRoteomics IDEntifications database

More...
PRIDEi
O75953

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
50319 [O75953-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75953

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75953

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expressed under normal conditions, its expression can further be increased after various stress treatments.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137094 Expressed in gastrocnemius and 191 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75953 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75953 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000137094 Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117350, 35 interactors

Protein interaction database and analysis system

More...
IntActi
O75953, 36 interactors

Molecular INTeraction database

More...
MINTi
O75953

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000404079

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O75953 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75953

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 68JPROSITE-ProRule annotationAdd BLAST65

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0714 Eukaryota
COG0484 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156090

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017633_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75953

KEGG Orthology (KO)

More...
KOi
K09511

Identification of Orthologs from Complete Genome Data

More...
OMAi
DVHWTLA

Database of Orthologous Groups

More...
OrthoDBi
1393097at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75953

TreeFam database of animal gene trees

More...
TreeFami
TF105141

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06257 DnaJ, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.110, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002939 DnaJ_C
IPR001623 DnaJ_domain
IPR018253 DnaJ_domain_CS
IPR008971 HSP40/DnaJ_pept-bd
IPR036869 J_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00226 DnaJ, 1 hit
PF01556 DnaJ_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00625 JDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00271 DnaJ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46565 SSF46565, 1 hit
SSF49493 SSF49493, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00636 DNAJ_1, 1 hit
PS50076 DNAJ_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75953-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKDYYKILG IPSGANEDEI KKAYRKMALK YHPDKNKEPN AEEKFKEIAE
60 70 80 90 100
AYDVLSDPKK RGLYDQYGEE GLKTGGGTSG GSSGSFHYTF HGDPHATFAS
110 120 130 140 150
FFGGSNPFDI FFASSRSTRP FSGFDPDDMD VDEDEDPFGA FGRFGFNGLS
160 170 180 190 200
RGPRRAPEPL YPRRKVQDPP VVHELRVSLE EIYHGSTKRM KITRRRLNPD
210 220 230 240 250
GRTVRTEDKI LHIVIKRGWK EGTKITFPKE GDATPDNIPA DIVFVLKDKP
260 270 280 290 300
HAHFRRDGTN VLYSALISLK EALCGCTVNI PTIDGRVIPL PCNDVIKPGT
310 320 330 340
VKRLRGEGLP FPKVPTQRGD LIVEFKVRFP DRLTPQTRQI LKQHLPCS
Length:348
Mass (Da):39,133
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC9FE45DE4FD8CFC
GO
Isoform 2 (identifier: O75953-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFKRTVLSCPPPAAPPLQARGAFRSFPHSWGEDFLASLMFKIQLEPLKLRAWTLNGFVKFRNKETSAGPVAVM

Show »
Length:420
Mass (Da):47,175
Checksum:i946F7B3E1D71BFB2
GO
Isoform 3 (identifier: O75953-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGAEAEPWG...ETSAGPVAVM

Show »
Length:462
Mass (Da):51,689
Checksum:iB5F3CFA21A956470
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T657Q5T657_HUMAN
DnaJ homolog subfamily B member 5
DNAJB5
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4S1H0Y4S1_HUMAN
DnaJ homolog subfamily B member 5
DNAJB5
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFL9H0YFL9_HUMAN
DnaJ homolog subfamily B member 5
DNAJB5
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH04H0YH04_HUMAN
DnaJ homolog subfamily B member 5
DNAJB5
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5W0H7C5W0_HUMAN
DnaJ homolog subfamily B member 5
DNAJB5
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH12115 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti190 – 196MKITRRR → IEDHKAS in AAM10498 (Ref. 2) Curated7
Sequence conflicti234 – 235TP → HL in AAM10498 (Ref. 2) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0462231M → MFKRTVLSCPPPAAPPLQAR GAFRSFPHSWGEDFLASLMF KIQLEPLKLRAWTLNGFVKF RNKETSAGPVAVM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0472501M → MGGAEAEPWGRAPGPAIGGR RAGDSCPGWRRRSRSRGRGQ RLSHGPRRRPQLLTAAPPLQ ARGAFRSFPHSWGEDFLASL MFKIQLEPLKLRAWTLNGFV KFRNKETSAGPVAVM in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF088982 mRNA Translation: AAC35860.1
AF087870 mRNA Translation: AAM10498.1
AK023253 mRNA Translation: BAG51176.1
AK299647 mRNA Translation: BAG61568.1
AL355377 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58407.1
BC012115 mRNA Translation: AAH12115.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35007.1 [O75953-3]
CCDS47959.1 [O75953-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001128476.2, NM_001135004.2
NP_001128477.1, NM_001135005.2 [O75953-4]
NP_036398.3, NM_012266.5 [O75953-3]
XP_005251485.1, XM_005251428.3 [O75953-3]
XP_006716814.1, XM_006716751.2
XP_011516144.1, XM_011517842.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312316; ENSP00000312517; ENSG00000137094 [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094 [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094 [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094 [O75953-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25822

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25822

UCSC genome browser

More...
UCSCi
uc003zvs.5 human [O75953-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088982 mRNA Translation: AAC35860.1
AF087870 mRNA Translation: AAM10498.1
AK023253 mRNA Translation: BAG51176.1
AK299647 mRNA Translation: BAG61568.1
AL355377 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58407.1
BC012115 mRNA Translation: AAH12115.1 Sequence problems.
CCDSiCCDS35007.1 [O75953-3]
CCDS47959.1 [O75953-4]
RefSeqiNP_001128476.2, NM_001135004.2
NP_001128477.1, NM_001135005.2 [O75953-4]
NP_036398.3, NM_012266.5 [O75953-3]
XP_005251485.1, XM_005251428.3 [O75953-3]
XP_006716814.1, XM_006716751.2
XP_011516144.1, XM_011517842.2

3D structure databases

SMRiO75953
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117350, 35 interactors
IntActiO75953, 36 interactors
MINTiO75953
STRINGi9606.ENSP00000404079

PTM databases

iPTMnetiO75953
PhosphoSitePlusiO75953

Polymorphism and mutation databases

BioMutaiDNAJB5

Proteomic databases

EPDiO75953
jPOSTiO75953
MassIVEiO75953
MaxQBiO75953
PaxDbiO75953
PeptideAtlasiO75953
PRIDEiO75953
ProteomicsDBi50319 [O75953-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
11397 174 antibodies

The DNASU plasmid repository

More...
DNASUi
25822

Genome annotation databases

EnsembliENST00000312316; ENSP00000312517; ENSG00000137094 [O75953-3]
ENST00000453597; ENSP00000404079; ENSG00000137094 [O75953-5]
ENST00000454002; ENSP00000413684; ENSG00000137094 [O75953-4]
ENST00000545841; ENSP00000441999; ENSG00000137094 [O75953-3]
GeneIDi25822
KEGGihsa:25822
UCSCiuc003zvs.5 human [O75953-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25822
DisGeNETi25822

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAJB5
HGNCiHGNC:14887 DNAJB5
HPAiENSG00000137094 Tissue enhanced (skeletal)
MIMi611328 gene
neXtProtiNX_O75953
OpenTargetsiENSG00000137094
PharmGKBiPA27417

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0714 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00940000156090
HOGENOMiCLU_017633_0_0_1
InParanoidiO75953
KOiK09511
OMAiDVHWTLA
OrthoDBi1393097at2759
PhylomeDBiO75953
TreeFamiTF105141

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAJB5 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25822
PharosiO75953 Tbio

Protein Ontology

More...
PROi
PR:O75953
RNActiO75953 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000137094 Expressed in gastrocnemius and 191 other tissues
ExpressionAtlasiO75953 baseline and differential
GenevisibleiO75953 HS

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR002939 DnaJ_C
IPR001623 DnaJ_domain
IPR018253 DnaJ_domain_CS
IPR008971 HSP40/DnaJ_pept-bd
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF01556 DnaJ_C, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
SSF49493 SSF49493, 2 hits
PROSITEiView protein in PROSITE
PS00636 DNAJ_1, 1 hit
PS50076 DNAJ_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDNJB5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75953
Secondary accession number(s): B3KN14
, B4DSA6, J3KQM9, J3KR08, Q5T656, Q8TDR7, Q96EM4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: November 1, 1998
Last modified: April 22, 2020
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again