UniProtKB - O75936 (BODG_HUMAN)

BLAST

>sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens OX=9606 GN=BBOX1 PE=1 SV=1
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL
QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF
DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVENGN

Align
Format
Add to basket Added to basket
History
Entry version 162 (07 Nov 2018)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Gamma-butyrobetaine dioxygenase

Gene

BBOX1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Catalyzes the formation of L-carnitine from gamma-butyrobetaine.

Catalytic activityⁱ

4-trimethylammoniobutanoate + 2-oxoglutarate + O₂ = 3-hydroxy-4-trimethylammoniobutanoate + succinate + CO₂.1 Publication

Cofactorⁱ

Protein has several cofactor binding sites:

Fe²⁺CuratedNote: Binds 1 Fe²⁺ ion per subunit.Curated
L-ascorbate

Pathwayⁱ: carnitine biosynthesis

This protein is involved in the pathway carnitine biosynthesis, which is part of Amine and polyamine biosynthesis.
View all proteins of this organism that are known to be involved in the pathway carnitine biosynthesis and in Amine and polyamine biosynthesis.

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	38	Zinc	1
Metal bindingⁱ	40	Zinc	1
Metal bindingⁱ	43	Zinc	1
Metal bindingⁱ	82	Zinc	1
Metal bindingⁱ	202	Iron; catalyticCurated	1
Metal bindingⁱ	204	Iron; catalyticCurated	1
Metal bindingⁱ	347	Iron; catalyticCurated	1

GO - Molecular functionⁱ

gamma-butyrobetaine dioxygenase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 20599753
- 9753662
identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 25416956
iron ion binding Source: InterPro
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
zinc ion binding
Source: UniProtKB
Inferred from direct assayⁱ
- 20599753

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

carnitine biosynthetic process
Source: UniProtKB
Inferred from direct assayⁱ
- 20599753
- 9753662

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Dioxygenase, Oxidoreductase
Biological process	Carnitine biosynthesis
Ligand	Iron, Metal-binding, Zinc

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS05246-MONOMER
BRENDAⁱ	1.14.11.1 2681
Reactomeⁱ	R-HSA-71262 Carnitine synthesis
SABIO-RKⁱ	O75936
UniPathwayⁱ	UPA00118

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Gamma-butyrobetaine dioxygenase (EC:1.14.11.1) Alternative name(s): Gamma-butyrobetaine hydroxylase Short name: Gamma-BBH Gamma-butyrobetaine,2-oxoglutarate dioxygenase
Gene namesⁱ	Name:BBOX1 Synonyms:BBH, BBOX
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 11

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000129151.8
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:964 BBOX1
MIMⁱ	603312 gene
neXtProtⁱ	NX_O75936

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	8424
Open Targets More...OpenTargetsⁱ	ENSG00000129151
PharmGKBⁱ	PA25274

Chemistry databases

ChEMBLⁱ	CHEMBL2163175
Drug and drug target database More...DrugBankⁱ	DB00139 Succinic acid DB00126 Vitamin C

Polymorphism and mutation databases

BioMutaⁱ	BBOX1

BioMutaⁱ

BBOX1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000207085	1 – 387	Gamma-butyrobetaine dioxygenaseAdd BLAST		387

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	351	PhosphoserineBy similarity		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	O75936
PaxDbⁱ	O75936
PeptideAtlas More...PeptideAtlasⁱ	O75936
PRIDEⁱ	O75936
ProteomicsDBⁱ	50301

PTM databases

iPTMnetⁱ	O75936
PhosphoSitePlusⁱ	O75936

Expressionⁱ

Tissue specificityⁱ

Highly expressed in kidney; moderately expressed in liver; very low expression in brain.

Gene expression databases

Bgeeⁱ	ENSG00000129151 Expressed in 156 organ(s), highest expression level in nephron tubule
CleanExⁱ	HS_BBOX1
ExpressionAtlasⁱ	O75936 baseline and differential
Genevisibleⁱ	O75936 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA007600 HPA027823

HPAⁱ

HPA007600
HPA027823

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
itself		3	EBI-715662,EBI-715662
SHTN1	A0MZ66-7	3	EBI-715662,EBI-10171490

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 25416956

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	114008, 19 interactors
IntActⁱ	O75936, 2 interactors
STRINGⁱ	9606.ENSP00000263182

Chemistry databases

BindingDBⁱ

O75936

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Turnⁱ	1 – 3	Combined sources	3
Beta strandⁱ	4 – 11	Combined sources	8
Turnⁱ	12 – 15	Combined sources	4
Beta strandⁱ	16 – 21	Combined sources	6
Beta strandⁱ	26 – 30	Combined sources	5
Helixⁱ	31 – 36	Combined sources	6
Turnⁱ	41 – 43	Combined sources	3
Turnⁱ	46 – 49	Combined sources	4
Helixⁱ	55 – 57	Combined sources	3
Beta strandⁱ	65 – 69	Combined sources	5
Beta strandⁱ	71 – 77	Combined sources	7
Beta strandⁱ	83 – 87	Combined sources	5
Helixⁱ	88 – 93	Combined sources	6
Helixⁱ	98 – 109	Combined sources	12
Beta strandⁱ	124 – 126	Combined sources	3
Helixⁱ	127 – 132	Combined sources	6
Helixⁱ	134 – 147	Combined sources	14
Beta strandⁱ	148 – 153	Combined sources	6
Beta strandⁱ	157 – 159	Combined sources	3
Helixⁱ	161 – 169	Combined sources	9
Beta strandⁱ	178 – 184	Combined sources	7
Helixⁱ	192 – 194	Combined sources	3
Beta strandⁱ	195 – 197	Combined sources	3
Beta strandⁱ	199 – 202	Combined sources	4
Beta strandⁱ	208 – 210	Combined sources	3
Beta strandⁱ	213 – 221	Combined sources	9
Beta strandⁱ	224 – 226	Combined sources	3
Beta strandⁱ	229 – 233	Combined sources	5
Helixⁱ	234 – 244	Combined sources	11
Helixⁱ	246 – 252	Combined sources	7
Beta strandⁱ	256 – 280	Combined sources	25
Beta strandⁱ	286 – 289	Combined sources	4
Turnⁱ	293 – 295	Combined sources	3
Helixⁱ	304 – 306	Combined sources	3
Helixⁱ	307 – 322	Combined sources	16
Turnⁱ	324 – 326	Combined sources	3
Beta strandⁱ	328 – 330	Combined sources	3
Beta strandⁱ	337 – 341	Combined sources	5
Turnⁱ	342 – 344	Combined sources	3
Beta strandⁱ	345 – 349	Combined sources	5
Beta strandⁱ	361 – 367	Combined sources	7
Helixⁱ	369 – 383	Combined sources	15

Show more details

3D structure databases

ProteinModelPortalⁱ	O75936
SMRⁱ	O75936
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O75936

EvolutionaryTraceⁱ

O75936

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the gamma-BBH/TMLD family.Curated

Phylogenomic databases

eggNOGⁱ	KOG3888 Eukaryota COG2175 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063582
HOGENOMⁱ	HOG000231427
HOVERGENⁱ	HBG031125
InParanoidⁱ	O75936
KEGG Orthology (KO) More...KOⁱ	K00471
OMAⁱ	PWYEAMA
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G062L
PhylomeDBⁱ	O75936
TreeFamⁱ	TF313805

Family and domain databases

Gene3Dⁱ	3.30.2020.30, 1 hit
InterProⁱ	View protein in InterPro IPR012775 GBBH IPR038492 GBBH-like_N_sf IPR010376 GBH-like_N IPR003819 TauD/TfdA-like
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF06155 DUF971, 1 hit PF02668 TauD, 1 hit
TIGRFAMsⁱ	TIGR02409 carnitine_bodg, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

O75936-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MACTIQKAEA LDGAHLMQIL WYDEEESLYP AVWLRDNCPC SDCYLDSAKA 
        60         70         80         90        100
RKLLVEALDV NIGIKGLIFD RKKVYITWPD EHYSEFQADW LKKRCFSKQA 
       110        120        130        140        150
RAKLQRELFF PECQYWGSEL QLPTLDFEDV LRYDEHAYKW LSTLKKVGIV 
       160        170        180        190        200
RLTGASDKPG EVSKLGKRMG FLYLTFYGHT WQVQDKIDAN NVAYTTGKLS 
       210        220        230        240        250
FHTDYPALHH PPGVQLLHCI KQTVTGGDSE IVDGFNVCQK LKKNNPQAFQ 
       260        270        280        290        300
ILSSTFVDFT DIGVDYCDFS VQSKHKIIEL DDKGQVVRIN FNNATRDTIF 
       310        320        330        340        350
DVPVERVQPF YAALKEFVDL MNSKESKFTF KMNPGDVITF DNWRLLHGRR 
       360        370        380 
SYEAGTEISR HLEGAYADWD VVMSRLRILR QRVENGN

Length:387

Mass (Da):44,715

Last modified:November 1, 1998 - v1

Checksum:ⁱA3BA3F9FA9355DB3

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	E9PKC9	E9PKC9_HUMAN		Gamma-butyrobetaine dioxygenase Gamma-butyrobetaine dioxygenase	BBOX1	68	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF082868 mRNA Translation: AAC64066.1 CR456812 mRNA Translation: CAG33093.1 AK313422 mRNA Translation: BAG36214.1 CH471064 Genomic DNA Translation: EAW68290.1 CH471064 Genomic DNA Translation: EAW68291.1 BC011034 mRNA Translation: AAH11034.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS7862.1
PIRⁱ	JE0360
NCBI Reference Sequences More...RefSeqⁱ	NP_003977.1, NM_003986.2 XP_005253216.1, XM_005253159.2 XP_005253217.1, XM_005253160.2 XP_005253218.1, XM_005253161.2 XP_011518704.1, XM_011520402.1 XP_016873892.1, XM_017018403.1
UniGeneⁱ	Hs.591996

Genome annotation databases

Ensemblⁱ	ENST00000263182; ENSP00000263182; ENSG00000129151 ENST00000525090; ENSP00000433772; ENSG00000129151 ENST00000528583; ENSP00000434918; ENSG00000129151 ENST00000529202; ENSP00000435781; ENSG00000129151
GeneIDⁱ	8424
KEGGⁱ	hsa:8424
UCSC genome browser More...UCSCⁱ	uc001mre.1 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O75936	BBOX1 isoform 1		PANTR		387	UniRef100_O75936
Uncharacterized protein		PANPA		387
Gamma-butyrobetaine hydroxylase 1		GORGO		387
Gamma-butyrobetaine hydroxylase (Fragment)		HUMAN		27
Gamma-butyrobetaine dioxygenase (Fragment)		HUMAN		68
+3

Protein	Similar proteins		Species	Score	Length	Source
O75936	Gamma-butyrobetaine dioxygenase		PONAB		387	UniRef90_O75936
BBOX1 isoform 1		PANTR		387
Uncharacterized protein		PANPA		387
Gamma-butyrobetaine hydroxylase 1		GORGO		387
Gamma-butyrobetaine hydroxylase (Fragment)		HUMAN		27
+51

Protein	Similar proteins		Species	Score	Length	Source
O75936	Gamma-butyrobetaine dioxygenase		PONAB		387	UniRef50_O75936
BBOX1 isoform 1		PANTR		387
Uncharacterized protein		PANPA		387
Gamma-butyrobetaine hydroxylase 1		GORGO		387
Gamma-butyrobetaine hydroxylase (Fragment)		HUMAN		27
+136

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF082868 mRNA Translation: AAC64066.1 CR456812 mRNA Translation: CAG33093.1 AK313422 mRNA Translation: BAG36214.1 CH471064 Genomic DNA Translation: EAW68290.1 CH471064 Genomic DNA Translation: EAW68291.1 BC011034 mRNA Translation: AAH11034.1
CCDSⁱ	CCDS7862.1
PIRⁱ	JE0360
RefSeqⁱ	NP_003977.1, NM_003986.2 XP_005253216.1, XM_005253159.2 XP_005253217.1, XM_005253160.2 XP_005253218.1, XM_005253161.2 XP_011518704.1, XM_011520402.1 XP_016873892.1, XM_017018403.1
UniGeneⁱ	Hs.591996

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3MS5	X-ray	1.82	A	1-387	[»]
	3N6W	X-ray	2.00	A	1-387	[»]
	3O2G	X-ray	1.78	A	1-387	[»]
	4BG1	X-ray	1.89	A	1-387	[»]
	4BGK	X-ray	2.18	A	1-387	[»]
	4BGM	X-ray	2.40	A	1-387	[»]
	4BHF	X-ray	2.05	A	1-387	[»]
	4BHG	X-ray	1.85	A	1-387	[»]
	4BHI	X-ray	2.15	A	1-387	[»]
	4C5W	X-ray	1.70	A	1-387	[»]
	4C8R	X-ray	2.82	A/B/C/D/E/F	1-387	[»]
	4CWD	X-ray	1.90	A	1-387	[»]
ProteinModelPortalⁱ	O75936
SMRⁱ	O75936
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114008, 19 interactors
IntActⁱ	O75936, 2 interactors
STRINGⁱ	9606.ENSP00000263182

Chemistry databases

BindingDBⁱ	O75936
ChEMBLⁱ	CHEMBL2163175
DrugBankⁱ	DB00139 Succinic acid DB00126 Vitamin C

PTM databases

iPTMnetⁱ	O75936
PhosphoSitePlusⁱ	O75936

Polymorphism and mutation databases

BioMutaⁱ	BBOX1

BioMutaⁱ

BBOX1

Proteomic databases

EPDⁱ	O75936
PaxDbⁱ	O75936
PeptideAtlasⁱ	O75936
PRIDEⁱ	O75936
ProteomicsDBⁱ	50301

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	8424
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000263182; ENSP00000263182; ENSG00000129151 ENST00000525090; ENSP00000433772; ENSG00000129151 ENST00000528583; ENSP00000434918; ENSG00000129151 ENST00000529202; ENSP00000435781; ENSG00000129151
GeneIDⁱ	8424
KEGGⁱ	hsa:8424
UCSCⁱ	uc001mre.1 human

Organism-specific databases

CTDⁱ	8424
DisGeNETⁱ	8424
EuPathDBⁱ	HostDB:ENSG00000129151.8
GeneCardsⁱ	BBOX1
HGNCⁱ	HGNC:964 BBOX1
HPAⁱ	HPA007600 HPA027823
MIMⁱ	603312 gene
neXtProtⁱ	NX_O75936
OpenTargetsⁱ	ENSG00000129151
PharmGKBⁱ	PA25274
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3888 Eukaryota COG2175 LUCA
GeneTreeⁱ	ENSGT00530000063582
HOGENOMⁱ	HOG000231427
HOVERGENⁱ	HBG031125
InParanoidⁱ	O75936
KOⁱ	K00471
OMAⁱ	PWYEAMA
OrthoDBⁱ	EOG091G062L
PhylomeDBⁱ	O75936
TreeFamⁱ	TF313805

Enzyme and pathway databases

UniPathwayⁱ	UPA00118
BioCycⁱ	MetaCyc:HS05246-MONOMER
BRENDAⁱ	1.14.11.1 2681
Reactomeⁱ	R-HSA-71262 Carnitine synthesis
SABIO-RKⁱ	O75936

Miscellaneous databases

ChiTaRSⁱ	BBOX1 human
EvolutionaryTraceⁱ	O75936
GeneWikiⁱ	Gamma-butyrobetaine_dioxygenase
GenomeRNAiⁱ	8424
Protein Ontology More...PROⁱ	PR:O75936
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000129151 Expressed in 156 organ(s), highest expression level in nephron tubule
CleanExⁱ	HS_BBOX1
ExpressionAtlasⁱ	O75936 baseline and differential
Genevisibleⁱ	O75936 HS

Family and domain databases

Gene3Dⁱ	3.30.2020.30, 1 hit
InterProⁱ	View protein in InterPro IPR012775 GBBH IPR038492 GBBH-like_N_sf IPR010376 GBH-like_N IPR003819 TauD/TfdA-like
Pfamⁱ	View protein in Pfam PF06155 DUF971, 1 hit PF02668 TauD, 1 hit
TIGRFAMsⁱ	TIGR02409 carnitine_bodg, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BODG_HUMAN
Accessionⁱ	O75936Primary (citable) accession number: O75936 Secondary accession number(s): B2R8L7, D3DQZ1, Q6IBJ2
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 15, 1999
	Last sequence update:	November 1, 1998
	Last modified:	November 7, 2018
	This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75936 (BODG_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Gamma-butyrobetaine dioxygenase

BBOX1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: carnitine biosynthesis

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Extracellular region or secreted

Mitochondrion

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Pathwayⁱ: carnitine biosynthesis

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ