UniProtKB - O75934 (SPF27_HUMAN)

BLAST

>sp|O75934|SPF27_HUMAN Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA
FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVR
IENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLRE
MESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Align
Format
Add to basket Added to basket
History
Entry version 162 (07 Nov 2018)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Pre-mRNA-splicing factor SPF27

Gene

BCAS2

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).1 Publication

GO - Biological processⁱ

mRNA splicing, via spliceosome Source: Reactome
RNA splicing
Source: UniProtKB
Traceable author statementⁱ
- 9731529
RNA splicing, via transesterification reactions
Source: UniProtKB
Traceable author statementⁱ
- 9731529

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	mRNA processing, mRNA splicing

Biological process

mRNA processing, mRNA splicing

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Pre-mRNA-splicing factor SPF27 Alternative name(s): Breast carcinoma-amplified sequence 2 DNA amplified in mammary carcinoma 1 protein Spliceosome-associated protein SPF 27
Gene namesⁱ	Name:BCAS2 Synonyms:DAM1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000116752.5
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:975 BCAS2
MIMⁱ	605783 gene
neXtProtⁱ	NX_O75934

Keywords - Cellular componentⁱ

Nucleus, Spliceosome

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	10286
Open Targets More...OpenTargetsⁱ	ENSG00000116752
PharmGKBⁱ	PA25285

Polymorphism and mutation databases

BioMutaⁱ	BCAS2

BioMutaⁱ

BCAS2

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources1 Publication
ChainⁱPRO_0000064861	2 – 225	Pre-mRNA-splicing factor SPF27Add BLAST		224

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	2	N-acetylalanineCombined sources1 Publication		1
Modified residueⁱ	94	PhosphoserineCombined sources		1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	O75934
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O75934
PaxDbⁱ	O75934
PeptideAtlas More...PeptideAtlasⁱ	O75934
PRIDEⁱ	O75934
ProteomicsDBⁱ	50297
TopDownProteomicsⁱ	O75934

2D gel databases

SWISS-2DPAGEⁱ	O75934

SWISS-2DPAGEⁱ

O75934

PTM databases

iPTMnetⁱ	O75934
PhosphoSitePlusⁱ	O75934

Miscellaneous databases

PMAP-CutDBⁱ	O75934

PMAP-CutDBⁱ

O75934

Expressionⁱ

Tissue specificityⁱ

Ubiquitously expressed.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000116752 Expressed in 238 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_BCAS2
ExpressionAtlasⁱ	O75934 baseline and differential
Genevisibleⁱ	O75934 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA067881

HPAⁱ

HPA067881

Interactionⁱ

Subunit structureⁱ

Component of the PRP19-CDC5L splicing complex composed of a core complex comprising a homotetramer of PRPF19, CDC5L, PLRG1 and BCAS2, and at least three less stably associated proteins CTNNBL1, CWC15 and HSPA8. Interacts directly in the complex with PRPF19, CDC5L and PLRG1.2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
AIMP2	Q13155	7	EBI-1050106,EBI-745226
GOLGA2	Q08379	7	EBI-1050106,EBI-618309
HGS	O14964	3	EBI-1050106,EBI-740220
IKZF3	Q9UKT9	3	EBI-1050106,EBI-747204
KRT34	O76011	4	EBI-1050106,EBI-1047093
KRT40	Q6A162	3	EBI-1050106,EBI-10171697
LMO2	P25791-3	4	EBI-1050106,EBI-11959475
LMO4	P61968	4	EBI-1050106,EBI-2798728
PRPF19	Q9UMS4	2	EBI-1050106,EBI-395746
PRPF8	Q6P2Q9	2	EBI-1050106,EBI-538479
SF3B4	Q15427	2	EBI-1050106,EBI-348469
TCF4	P15884	3	EBI-1050106,EBI-533224

Protein-protein interaction databases

BioGridⁱ	115575, 111 interactors
CORUMⁱ	O75934
IntActⁱ	O75934, 74 interactors
Molecular INTeraction database More...MINTⁱ	O75934
STRINGⁱ	9606.ENSP00000358554

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O75934
SMRⁱ	O75934
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Coiled coil

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Coiled coilⁱ	138 – 222	Sequence analysisAdd BLAST		85

Sequence similaritiesⁱ

Belongs to the SPF27 family.Curated

Keywords - Domainⁱ

Coiled coil

Phylogenomic databases

eggNOGⁱ	KOG3096 Eukaryota ENOG41101IB LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000014494
HOGENOMⁱ	HOG000007540
HOVERGENⁱ	HBG050675
InParanoidⁱ	O75934
KEGG Orthology (KO) More...KOⁱ	K12861
OMAⁱ	QNRLPME
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0NMJ
PhylomeDBⁱ	O75934
TreeFamⁱ	TF105818

Family and domain databases

InterProⁱ	View protein in InterPro IPR008409 SPF27
PANTHERⁱ	PTHR13296 PTHR13296, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF05700 BCAS2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

O75934-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAGTGLVAGE VVVDALPYFD QGYEAPGVRE AAAALVEEET RRYRPTKNYL 
        60         70         80         90        100
SYLTAPDYSA FETDIMRNEF ERLAARQPIE LLSMKRYELP APSSGQKNDI 
       110        120        130        140        150
TAWQECVNNS MAQLEHQAVR IENLELMSQH GCNAWKVYNE NLVHMIEHAQ 
       160        170        180        190        200
KELQKLRKHI QDLNWQRKNM QLTAGSKLRE MESNWVSLVS KNYEIERTIV 
       210        220 
QLENEIYQIK QQHGEANKEN IRQDF

Length:225

Mass (Da):26,131

Last modified:November 1, 1998 - v1

Checksum:ⁱ9112718EEFD96890

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	24	E → D in CAG46834 (Ref. 3) Curated		1
Sequence conflictⁱ	89	L → V in CAG46834 (Ref. 3) Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_035799	139	N → S in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1197668726Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF081788 mRNA Translation: AAC64059.1 AB020623 mRNA Translation: BAA34863.1 CR542037 mRNA Translation: CAG46834.1 BT019390 mRNA Translation: AAV38197.1 AL390241 Genomic DNA No translation available. BC005285 mRNA Translation: AAH05285.1 BC012623 mRNA Translation: AAH12623.1 BC022880 mRNA Translation: AAH22880.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS874.1
NCBI Reference Sequences More...RefSeqⁱ	NP_005863.1, NM_005872.2
UniGeneⁱ	Hs.22960

Genome annotation databases

Ensemblⁱ	ENST00000369541; ENSP00000358554; ENSG00000116752
GeneIDⁱ	10286
KEGGⁱ	hsa:10286
UCSC genome browser More...UCSCⁱ	uc001efa.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O75934	Pre-mRNA-splicing factor SPF27		MOUSE		225	UniRef100_O75934
pre-mRNA-splicing factor SPF27		TARSY		229
Breast carcinoma amplified sequence 2		HUMAN		225
Pre-mRNA-splicing factor SPF27		MACMU		225
BCAS2 isoform 1		PANTR		225
+17

Protein	Similar proteins		Species	Score	Length	Source
O75934	Pre-mRNA-splicing factor SPF27		MOUSE		225	UniRef90_O75934
Pre-mRNA-splicing factor SPF27		PONAB		226
pre-mRNA-splicing factor SPF27		TARSY		229
Breast carcinoma amplified sequence 2		HUMAN		225
Pre-mRNA-splicing factor SPF27		MACMU		225
+116

Protein	Similar proteins		Species	Score	Length	Source
O75934	Pre-mRNA-splicing factor SPF27		MOUSE		225	UniRef50_O75934
Pre-mRNA-splicing factor SPF27		PONAB		226
pre-mRNA-splicing factor SPF27		TARSY		229
Breast carcinoma amplified sequence 2		HUMAN		225
Pre-mRNA-splicing factor SPF27		MACMU		225
+155

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF081788 mRNA Translation: AAC64059.1 AB020623 mRNA Translation: BAA34863.1 CR542037 mRNA Translation: CAG46834.1 BT019390 mRNA Translation: AAV38197.1 AL390241 Genomic DNA No translation available. BC005285 mRNA Translation: AAH05285.1 BC012623 mRNA Translation: AAH12623.1 BC022880 mRNA Translation: AAH22880.1
CCDSⁱ	CCDS874.1
RefSeqⁱ	NP_005863.1, NM_005872.2
UniGeneⁱ	Hs.22960

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	5MQF	electron microscopy	5.90	K	1-225	[»]
	5XJC	electron microscopy	3.60	K	1-225	[»]
	5YZG	electron microscopy	4.10	K	1-225	[»]
	5Z56	electron microscopy	5.10	K	1-225	[»]
	5Z57	electron microscopy	6.50	K	1-225	[»]
ProteinModelPortalⁱ	O75934
SMRⁱ	O75934
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	115575, 111 interactors
CORUMⁱ	O75934
IntActⁱ	O75934, 74 interactors
MINTⁱ	O75934
STRINGⁱ	9606.ENSP00000358554

PTM databases

iPTMnetⁱ	O75934
PhosphoSitePlusⁱ	O75934

Polymorphism and mutation databases

BioMutaⁱ	BCAS2

BioMutaⁱ

BCAS2

2D gel databases

SWISS-2DPAGEⁱ	O75934

SWISS-2DPAGEⁱ

O75934

Proteomic databases

EPDⁱ	O75934
MaxQBⁱ	O75934
PaxDbⁱ	O75934
PeptideAtlasⁱ	O75934
PRIDEⁱ	O75934
ProteomicsDBⁱ	50297
TopDownProteomicsⁱ	O75934

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	10286
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000369541; ENSP00000358554; ENSG00000116752
GeneIDⁱ	10286
KEGGⁱ	hsa:10286
UCSCⁱ	uc001efa.4 human

Organism-specific databases

CTDⁱ	10286
DisGeNETⁱ	10286
EuPathDBⁱ	HostDB:ENSG00000116752.5
GeneCardsⁱ	BCAS2
H-InvDBⁱ	HIX0077639
HGNCⁱ	HGNC:975 BCAS2
HPAⁱ	HPA067881
MIMⁱ	605783 gene
neXtProtⁱ	NX_O75934
OpenTargetsⁱ	ENSG00000116752
PharmGKBⁱ	PA25285
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3096 Eukaryota ENOG41101IB LUCA
GeneTreeⁱ	ENSGT00390000014494
HOGENOMⁱ	HOG000007540
HOVERGENⁱ	HBG050675
InParanoidⁱ	O75934
KOⁱ	K12861
OMAⁱ	QNRLPME
OrthoDBⁱ	EOG091G0NMJ
PhylomeDBⁱ	O75934
TreeFamⁱ	TF105818

Enzyme and pathway databases

Reactomeⁱ	R-HSA-72163 mRNA Splicing - Major Pathway

Reactomeⁱ

R-HSA-72163 mRNA Splicing - Major Pathway

Miscellaneous databases

ChiTaRSⁱ	BCAS2 human
GeneWikiⁱ	BCAS2
GenomeRNAiⁱ	10286
PMAP-CutDBⁱ	O75934
Protein Ontology More...PROⁱ	PR:O75934
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000116752 Expressed in 238 organ(s), highest expression level in frontal cortex
CleanExⁱ	HS_BCAS2
ExpressionAtlasⁱ	O75934 baseline and differential
Genevisibleⁱ	O75934 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR008409 SPF27
PANTHERⁱ	PTHR13296 PTHR13296, 1 hit
Pfamⁱ	View protein in Pfam PF05700 BCAS2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SPF27_HUMAN
Accessionⁱ	O75934Primary (citable) accession number: O75934 Secondary accession number(s): Q6FGS0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 10, 2005
	Last sequence update:	November 1, 1998
	Last modified:	November 7, 2018
	This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75934 (SPF27_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Pre-mRNA-splicing factor SPF27

BCAS2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Cytoskeleton

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ