Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75900 (MMP23_HUMAN)

Entry version 168 (02 Jun 2021)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Matrix metalloproteinase-23

Gene

MMP23B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity).

By similarity

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by TIMP2.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi211Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei212PROSITE-ProRule annotation1
Metal bindingi215Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi221Zinc; catalyticPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75900

Protein family/group databases

MEROPS protease database

More...MEROPSi		M10.022

Transport Classification Database

More...TCDBi		8.B.14.2.2, the sea anemone peptide toxin, class 1 (bgk) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Matrix metalloproteinase-23 (EC:3.4.24.-)
Short name:
MMP-23
Alternative name(s):
Femalysin
MIFR-1
Matrix metalloproteinase-21
Short name:
MMP-21
Matrix metalloproteinase-22
Short name:
MMP-22
Cleaved into the following chain:
Matrix metalloproteinase-23, soluble form
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MMP23B
Synonyms:MMP21, MMP22
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7171, MMP23B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603320, gene
603321, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75900

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000189409.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 19CytoplasmicSequence analysisAdd BLAST19
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei20 – 40Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini41 – 390LumenalSequence analysisAdd BLAST350

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi78R → G: Abolishes processing of soluble form. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		8510

Open Targets

More...OpenTargetsi		ENSG00000189409

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30880

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75900, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB00786, Marimastat

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HGNC:7170

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002595131 – 390Matrix metalloproteinase-23Add BLAST390
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00002595141 – 78Sequence analysisAdd BLAST78
ChainiPRO_000025951579 – 390Matrix metalloproteinase-23, soluble formAdd BLAST312

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi92N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi148N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi232N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi255 ↔ 289By similarity
Disulfide bondi262 ↔ 282By similarity
Disulfide bondi271 ↔ 286By similarity
Glycosylationi316N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi321 ↔ 370By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication
Proteolytic cleavage might yield an active form.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei78 – 79Cleavage; by furin-like proteaseSequence analysis2

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-2612

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75900

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75900

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75900

PeptideAtlas

More...PeptideAtlasi		O75900

PRoteomics IDEntifications database

More...PRIDEi		O75900

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		50253 [O75900-1]
50254 [O75900-2]
50255 [O75900-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O75900, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75900

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75900

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in ovary, testis and prostate.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000189409, Expressed in heart left ventricle and 111 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75900, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75900, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000189409, Tissue enhanced (ovary)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114082, 2 interactors

Protein interaction database and analysis system

More...IntActi		O75900, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000348308

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75900, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		O75900

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini255 – 289ShKTPROSITE-ProRule annotationAdd BLAST35
Domaini295 – 380Ig-like C2-typeAdd BLAST86

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ShKT domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4 (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M10A family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1565, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161187

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015489_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75900

Identification of Orthologs from Complete Genome Data

More...OMAi		AKAFGMW

Database of Orthologous Groups

More...OrthoDBi		1075463at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75900

TreeFam database of animal gene trees

More...TreeFami		TF315428

Family and domain databases

Conserved Domains Database

More...CDDi		cd04278, ZnMc_MMP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR033739, M10A_MMP
IPR024079, MetalloPept_cat_dom_sf
IPR028687, MMP23
IPR001818, Pept_M10_metallopeptidase
IPR021190, Pept_M10A
IPR006026, Peptidase_Metallo
IPR003582, ShKT_dom

The PANTHER Classification System

More...PANTHERi		PTHR10201:SF7, PTHR10201:SF7, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00413, Peptidase_M10, 1 hit
PF01549, ShK, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00138, MATRIXIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 1 hit
SM00254, ShKT, 1 hit
SM00235, ZnMc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS51670, SHKT, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75900-1) [UniParc]FASTAAdd to basket
Also known as: MMP21/22A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRGARVPSE APGAGVERRW LGAALVALCL LPALVLLARL GAPAVPAWSA 
        60         70         80         90        100
AQGDVAALGL SAVPPTRVPG PLAPRRRRYT LTPARLRWDH FNLTYRILSF 
       110        120        130        140        150
PRNLLSPRET RRALAAAFRM WSDVSPFSFR EVAPEQPSDL RIGFYPINHT 
       160        170        180        190        200
DCLVSALHHC FDGPTGELAH AFFPPHGGIH FDDSEYWVLG PTRYSWKKGV 
       210        220        230        240        250
WLTDLVHVAA HEIGHALGLM HSQHGRALMH LNATLRGWKA LSQDELWGLH 
       260        270        280        290        300
RLYGCLDRLF VCASWARRGF CDARRRLMKR LCPSSCDFCY EFPFPTVATT 
       310        320        330        340        350
PPPPRTKTRL VPEGRNVTFR CGQKILHKKG KVYWYKDQEP LEFSYPGYLA 
       360        370        380        390
LGEAHLSIIA NAVNEGTYTC VVRRQQRVLT TYSWRVRVRG
Length:390
Mass (Da):43,935
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5D78E4B4F2053D15
GO
Isoform 2 (identifier: O75900-2) [UniParc]FASTAAdd to basket
Also known as: MMP21/22B

The sequence of this isoform differs from the canonical sequence as follows:
     199-199: G → GDRPGSSWRPLLCSTVGCRGRALGQTAGGTFRGGGCHWSLAG

Show »
Length:431
Mass (Da):48,107
Checksum:i807BA712BA201EF1
GO
Isoform 3 (identifier: O75900-3) [UniParc]FASTAAdd to basket
Also known as: MMP21/22C

The sequence of this isoform differs from the canonical sequence as follows:
     254-254: G → GESLCRAGGRGPGGPEPGVLPTLPIG

Show »
Length:415
Mass (Da):46,305
Checksum:iCD428F3F07F226EB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
O75086O75086_HUMAN
MIFR-2
MMP23B mifr-2
386Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DMZ6B4DMZ6_HUMAN
Matrix metalloproteinase-23
MMP23B
238Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6I4H0Y6I4_HUMAN
Matrix metalloproteinase-23
MMP23B
242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REP6D6REP6_HUMAN
Matrix metalloproteinase-23
MMP23B
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAE5H0YAE5_HUMAN
Matrix metalloproteinase-23
MMP23B
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA69H0YA69_HUMAN
Matrix metalloproteinase-23
MMP23B
265Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRS4J3KRS4_HUMAN
Matrix metalloproteinase-23
MMP23B
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02894891F → L1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_021411199G → GDRPGSSWRPLLCSTVGCRG RALGQTAGGTFRGGGCHWSL AG in isoform 2. 1 Publication1
Alternative sequenceiVSP_021412254G → GESLCRAGGRGPGGPEPGVL PTLPIG in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF055334 Genomic DNA Translation: AAC63527.1
AF055334 Genomic DNA Translation: AAC63528.1
AF055334 Genomic DNA Translation: AAC63529.1
AF056200 mRNA Translation: AAC62616.1
AF057061 mRNA Translation: AAC62617.1
AF057062 mRNA Translation: AAC62618.1
AJ005256 mRNA Translation: CAB38176.1
AB031068 Genomic DNA Translation: BAA92769.1
AB010961 mRNA Translation: BAA24833.1
AL691432 Genomic DNA No translation available.
BC025719 mRNA Translation: AAH25719.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS30559.1 [O75900-1]

NCBI Reference Sequences

More...RefSeqi		NP_008914.1, NM_006983.1 [O75900-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000356026; ENSP00000348308; ENSG00000189409 [O75900-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8510

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8510

UCSC genome browser

More...UCSCi		uc001agp.4, human [O75900-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF055334 Genomic DNA Translation: AAC63527.1
AF055334 Genomic DNA Translation: AAC63528.1
AF055334 Genomic DNA Translation: AAC63529.1
AF056200 mRNA Translation: AAC62616.1
AF057061 mRNA Translation: AAC62617.1
AF057062 mRNA Translation: AAC62618.1
AJ005256 mRNA Translation: CAB38176.1
AB031068 Genomic DNA Translation: BAA92769.1
AB010961 mRNA Translation: BAA24833.1
AL691432 Genomic DNA No translation available.
BC025719 mRNA Translation: AAH25719.1
CCDSiCCDS30559.1 [O75900-1]
RefSeqiNP_008914.1, NM_006983.1 [O75900-1]

3D structure databases

BMRBiO75900
ModBaseiSearch...
SWISS-MODEL-WorkspaceiSubmit a new modelling project...

Protein-protein interaction databases

BioGRIDi114082, 2 interactors
IntActiO75900, 1 interactor
STRINGi9606.ENSP00000348308

Chemistry databases

DrugBankiDB00786, Marimastat

Protein family/group databases

MEROPSiM10.022
TCDBi8.B.14.2.2, the sea anemone peptide toxin, class 1 (bgk) family

PTM databases

GlyGeniO75900, 4 sites
iPTMnetiO75900
PhosphoSitePlusiO75900

Genetic variation databases

BioMutaiHGNC:7170

Proteomic databases

CPTACiCPTAC-2612
jPOSTiO75900
MassIVEiO75900
PaxDbiO75900
PeptideAtlasiO75900
PRIDEiO75900
ProteomicsDBi50253 [O75900-1]
50254 [O75900-2]
50255 [O75900-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3453, 365 antibodies

The DNASU plasmid repository

More...DNASUi		8510

Genome annotation databases

EnsembliENST00000356026; ENSP00000348308; ENSG00000189409 [O75900-1]
GeneIDi8510
KEGGihsa:8510
UCSCiuc001agp.4, human [O75900-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8510
DisGeNETi8510

GeneCards: human genes, protein and diseases

More...GeneCardsi		MMP23B
HGNCiHGNC:7171, MMP23B
HPAiENSG00000189409, Tissue enhanced (ovary)
MIMi603320, gene
603321, gene
neXtProtiNX_O75900
OpenTargetsiENSG00000189409
PharmGKBiPA30880
VEuPathDBiHostDB:ENSG00000189409.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1565, Eukaryota
GeneTreeiENSGT00940000161187
HOGENOMiCLU_015489_2_1_1
InParanoidiO75900
OMAiAKAFGMW
OrthoDBi1075463at2759
PhylomeDBiO75900
TreeFamiTF315428

Enzyme and pathway databases

PathwayCommonsiO75900

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8510, 11 hits in 981 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MMP23B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8510
PharosiO75900, Tbio

Protein Ontology

More...PROi		PR:O75900
RNActiO75900, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000189409, Expressed in heart left ventricle and 111 other tissues
ExpressionAtlasiO75900, baseline and differential
GenevisibleiO75900, HS

Family and domain databases

CDDicd04278, ZnMc_MMP, 1 hit
Gene3Di2.60.40.10, 1 hit
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR033739, M10A_MMP
IPR024079, MetalloPept_cat_dom_sf
IPR028687, MMP23
IPR001818, Pept_M10_metallopeptidase
IPR021190, Pept_M10A
IPR006026, Peptidase_Metallo
IPR003582, ShKT_dom
PANTHERiPTHR10201:SF7, PTHR10201:SF7, 1 hit
PfamiView protein in Pfam
PF00413, Peptidase_M10, 1 hit
PF01549, ShK, 1 hit
PRINTSiPR00138, MATRIXIN
SMARTiView protein in SMART
SM00409, IG, 1 hit
SM00254, ShKT, 1 hit
SM00235, ZnMc, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS51670, SHKT, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMMP23_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75900
Secondary accession number(s): A2AGN0
, A2AGN1, O75894, O75895, Q5QPQ8, Q76P96, Q7LDM6, Q7LDM7, Q9UBR9, Q9UJK8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: June 2, 2021
This is version 168 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again