Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Matrix metalloproteinase-23

Gene

MMP23A

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum (By similarity).By similarity

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Activity regulationi

Inhibited by TIMP2.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi211Zinc; catalyticPROSITE-ProRule annotation1
Active sitei212PROSITE-ProRule annotation1
Metal bindingi215Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi221Zinc; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

  • metalloendopeptidase activity Source: UniProtKB
  • metallopeptidase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

  • proteolysis Source: UniProtKB
  • reproduction Source: UniProtKB

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Protein family/group databases

MEROPSiM10.022

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix metalloproteinase-23 (EC:3.4.24.-)
Short name:
MMP-23
Alternative name(s):
Femalysin
MIFR-1
Matrix metalloproteinase-21
Short name:
MMP-21
Matrix metalloproteinase-22
Short name:
MMP-22
Cleaved into the following chain:
Gene namesi
Name:MMP23A
Synonyms:MMP21
AND
Name:MMP23B
Synonyms:MMP21, MMP22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000189409.12
HGNCiHGNC:7170 MMP23A
HGNC:7171 MMP23B
MIMi603320 gene
603321 gene
neXtProtiNX_O75900

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 19CytoplasmicSequence analysisAdd BLAST19
Transmembranei20 – 40Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini41 – 390LumenalSequence analysisAdd BLAST350

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi78R → G: Abolishes processing of soluble form. 1 Publication1

Organism-specific databases

DisGeNETi8510
8511
OpenTargetsiENSG00000189409
PharmGKBiPA30880

Chemistry databases

DrugBankiDB00786 Marimastat

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002595131 – 390Matrix metalloproteinase-23Add BLAST390
PropeptideiPRO_00002595141 – 78Sequence analysisAdd BLAST78
ChainiPRO_000025951579 – 390Matrix metalloproteinase-23, soluble formAdd BLAST312

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi92N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi148N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi232N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi255 ↔ 289By similarity
Disulfide bondi262 ↔ 282By similarity
Disulfide bondi271 ↔ 286By similarity
Glycosylationi316N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi321 ↔ 370By similarity

Post-translational modificationi

N-glycosylated.1 Publication
Proteolytic cleavage might yield an active form.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei78 – 79Cleavage; by furin-like proteaseSequence analysis2

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

PaxDbiO75900
PeptideAtlasiO75900
PRIDEiO75900
ProteomicsDBi50253
50254 [O75900-2]
50255 [O75900-3]

PTM databases

iPTMnetiO75900
PhosphoSitePlusiO75900

Expressioni

Tissue specificityi

Predominantly expressed in ovary, testis and prostate.1 Publication

Gene expression databases

BgeeiENSG00000189409 Expressed in 85 organ(s), highest expression level in heart left ventricle
CleanExiHS_MMP21
ExpressionAtlasiO75900 baseline and differential
GenevisibleiO75900 HS

Interactioni

Protein-protein interaction databases

BioGridi114082, 2 interactors
IntActiO75900, 1 interactor
STRINGi9606.ENSP00000348308

Structurei

3D structure databases

ProteinModelPortaliO75900
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini255 – 289ShKTPROSITE-ProRule annotationAdd BLAST35
Domaini295 – 380Ig-like C2-typeAdd BLAST86

Domaini

The ShKT domain associates with, and blocks several potassium channels in the nanomolar to low micromolar range. The relative affinity is Kv1.6 > Kv1.3 > Kv1.1 = Kv3.2 > Kv1.4 (By similarity).By similarity

Sequence similaritiesi

Belongs to the peptidase M10A family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1565 Eukaryota
ENOG410XQ5D LUCA
GeneTreeiENSGT00910000144034
HOVERGENiHBG053177
InParanoidiO75900
KOiK08001
OMAiDEVWGLH
OrthoDBiEOG091G03DP
PhylomeDBiO75900
TreeFamiTF315428

Family and domain databases

CDDicd04278 ZnMc_MMP, 1 hit
Gene3Di2.60.40.10, 1 hit
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR033739 M10A_MMP
IPR024079 MetalloPept_cat_dom_sf
IPR028687 MMP23
IPR001818 Pept_M10_metallopeptidase
IPR021190 Pept_M10A
IPR006026 Peptidase_Metallo
IPR003582 ShKT_dom
PANTHERiPTHR10201:SF7 PTHR10201:SF7, 1 hit
PfamiView protein in Pfam
PF00413 Peptidase_M10, 1 hit
PF01549 ShK, 1 hit
PRINTSiPR00138 MATRIXIN
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00254 ShKT, 1 hit
SM00235 ZnMc, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
PS51670 SHKT, 1 hit
PS00142 ZINC_PROTEASE, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75900-1) [UniParc]FASTAAdd to basket
Also known as: MMP21/22A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRGARVPSE APGAGVERRW LGAALVALCL LPALVLLARL GAPAVPAWSA
60 70 80 90 100
AQGDVAALGL SAVPPTRVPG PLAPRRRRYT LTPARLRWDH FNLTYRILSF
110 120 130 140 150
PRNLLSPRET RRALAAAFRM WSDVSPFSFR EVAPEQPSDL RIGFYPINHT
160 170 180 190 200
DCLVSALHHC FDGPTGELAH AFFPPHGGIH FDDSEYWVLG PTRYSWKKGV
210 220 230 240 250
WLTDLVHVAA HEIGHALGLM HSQHGRALMH LNATLRGWKA LSQDELWGLH
260 270 280 290 300
RLYGCLDRLF VCASWARRGF CDARRRLMKR LCPSSCDFCY EFPFPTVATT
310 320 330 340 350
PPPPRTKTRL VPEGRNVTFR CGQKILHKKG KVYWYKDQEP LEFSYPGYLA
360 370 380 390
LGEAHLSIIA NAVNEGTYTC VVRRQQRVLT TYSWRVRVRG
Length:390
Mass (Da):43,935
Last modified:October 31, 2006 - v2
Checksum:i5D78E4B4F2053D15
GO
Isoform 2 (identifier: O75900-2) [UniParc]FASTAAdd to basket
Also known as: MMP21/22B

The sequence of this isoform differs from the canonical sequence as follows:
     199-199: G → GDRPGSSWRPLLCSTVGCRGRALGQTAGGTFRGGGCHWSLAG

Show »
Length:431
Mass (Da):48,107
Checksum:i807BA712BA201EF1
GO
Isoform 3 (identifier: O75900-3) [UniParc]FASTAAdd to basket
Also known as: MMP21/22C

The sequence of this isoform differs from the canonical sequence as follows:
     254-254: G → GESLCRAGGRGPGGPEPGVLPTLPIG

Show »
Length:415
Mass (Da):46,305
Checksum:iCD428F3F07F226EB
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
O75086O75086_HUMAN
MIFR-2
MMP23B mifr-2
386Annotation score:
B4DMZ6B4DMZ6_HUMAN
Matrix metalloproteinase-23
MMP23B
238Annotation score:
H0Y6I4H0Y6I4_HUMAN
Matrix metalloproteinase-23
MMP23B
242Annotation score:
D6REP6D6REP6_HUMAN
Matrix metalloproteinase-23
MMP23B
166Annotation score:
J3KRS4J3KRS4_HUMAN
Matrix metalloproteinase-23
MMP23B
87Annotation score:
H0YA69H0YA69_HUMAN
Matrix metalloproteinase-23
MMP23B
265Annotation score:
H0YAE5H0YAE5_HUMAN
Matrix metalloproteinase-23
MMP23B
258Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02894891F → L1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021411199G → GDRPGSSWRPLLCSTVGCRG RALGQTAGGTFRGGGCHWSL AG in isoform 2. 1 Publication1
Alternative sequenceiVSP_021412254G → GESLCRAGGRGPGGPEPGVL PTLPIG in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF055334 Genomic DNA Translation: AAC63527.1
AF055334 Genomic DNA Translation: AAC63528.1
AF055334 Genomic DNA Translation: AAC63529.1
AF056200 mRNA Translation: AAC62616.1
AF057061 mRNA Translation: AAC62617.1
AF057062 mRNA Translation: AAC62618.1
AJ005256 mRNA Translation: CAB38176.1
AB031068 Genomic DNA Translation: BAA92769.1
AB010961 mRNA Translation: BAA24833.1
AL691432 Genomic DNA No translation available.
BC025719 mRNA Translation: AAH25719.1
CCDSiCCDS30559.1 [O75900-1]
RefSeqiNP_008914.1, NM_006983.1 [O75900-1]
UniGeneiHs.192316
Hs.671760

Genome annotation databases

EnsembliENST00000356026; ENSP00000348308; ENSG00000189409 [O75900-1]
GeneIDi8510
KEGGihsa:8510
UCSCiuc001agp.4 human [O75900-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF055334 Genomic DNA Translation: AAC63527.1
AF055334 Genomic DNA Translation: AAC63528.1
AF055334 Genomic DNA Translation: AAC63529.1
AF056200 mRNA Translation: AAC62616.1
AF057061 mRNA Translation: AAC62617.1
AF057062 mRNA Translation: AAC62618.1
AJ005256 mRNA Translation: CAB38176.1
AB031068 Genomic DNA Translation: BAA92769.1
AB010961 mRNA Translation: BAA24833.1
AL691432 Genomic DNA No translation available.
BC025719 mRNA Translation: AAH25719.1
CCDSiCCDS30559.1 [O75900-1]
RefSeqiNP_008914.1, NM_006983.1 [O75900-1]
UniGeneiHs.192316
Hs.671760

3D structure databases

ProteinModelPortaliO75900
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114082, 2 interactors
IntActiO75900, 1 interactor
STRINGi9606.ENSP00000348308

Chemistry databases

DrugBankiDB00786 Marimastat

Protein family/group databases

MEROPSiM10.022

PTM databases

iPTMnetiO75900
PhosphoSitePlusiO75900

Proteomic databases

PaxDbiO75900
PeptideAtlasiO75900
PRIDEiO75900
ProteomicsDBi50253
50254 [O75900-2]
50255 [O75900-3]

Protocols and materials databases

DNASUi8510
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356026; ENSP00000348308; ENSG00000189409 [O75900-1]
GeneIDi8510
KEGGihsa:8510
UCSCiuc001agp.4 human [O75900-1]

Organism-specific databases

CTDi8510
DisGeNETi8510
8511
EuPathDBiHostDB:ENSG00000189409.12
GeneCardsiMMP23A
MMP23B
H-InvDBiHIX0178039
HGNCiHGNC:7170 MMP23A
HGNC:7171 MMP23B
MIMi603320 gene
603321 gene
neXtProtiNX_O75900
OpenTargetsiENSG00000189409
PharmGKBiPA30880
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1565 Eukaryota
ENOG410XQ5D LUCA
GeneTreeiENSGT00910000144034
HOVERGENiHBG053177
InParanoidiO75900
KOiK08001
OMAiDEVWGLH
OrthoDBiEOG091G03DP
PhylomeDBiO75900
TreeFamiTF315428

Miscellaneous databases

ChiTaRSiMMP23B human
GeneWikiiMMP23B
GenomeRNAii8510
PROiPR:O75900
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000189409 Expressed in 85 organ(s), highest expression level in heart left ventricle
CleanExiHS_MMP21
ExpressionAtlasiO75900 baseline and differential
GenevisibleiO75900 HS

Family and domain databases

CDDicd04278 ZnMc_MMP, 1 hit
Gene3Di2.60.40.10, 1 hit
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR033739 M10A_MMP
IPR024079 MetalloPept_cat_dom_sf
IPR028687 MMP23
IPR001818 Pept_M10_metallopeptidase
IPR021190 Pept_M10A
IPR006026 Peptidase_Metallo
IPR003582 ShKT_dom
PANTHERiPTHR10201:SF7 PTHR10201:SF7, 1 hit
PfamiView protein in Pfam
PF00413 Peptidase_M10, 1 hit
PF01549 ShK, 1 hit
PRINTSiPR00138 MATRIXIN
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00254 ShKT, 1 hit
SM00235 ZnMc, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
PS51670 SHKT, 1 hit
PS00142 ZINC_PROTEASE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMMP23_HUMAN
AccessioniPrimary (citable) accession number: O75900
Secondary accession number(s): A2AGN0
, A2AGN1, O75894, O75895, Q5QPQ8, Q76P96, Q7LDM6, Q7LDM7, Q9UBR9, Q9UJK8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 7, 2018
This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again