Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative hydrolase RBBP9

Gene

RBBP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.

Miscellaneous

Interacts with the serine hydrolase-directed activity-based probe fluorophosphonate-rhodamine (FP-rhodamine). This interaction is inhibited selectively and reversibly by emetine, a compound with cytotoxic activity.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei75Charge relay systemSequence analysis1
Active sitei138Charge relay systemSequence analysis1
Active sitei165Charge relay systemSequence analysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...
ESTHERi
human-RBBP9 Hydrolase_RBBP9_YdeN

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Putative hydrolase RBBP9 (EC:3.-.-.-)
Alternative name(s):
B5T-overexpressed gene protein
Short name:
Protein BOG
Retinoblastoma-binding protein 10
Short name:
RBBP-10
Retinoblastoma-binding protein 9
Short name:
RBBP-9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBBP9
Synonyms:BOG, RBBP10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000089050.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9892 RBBP9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602908 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75884

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi63L → Q: Loss of retinoblastoma protein binding. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
10741

Open Targets

More...
OpenTargetsi
ENSG00000089050

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34256

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1075121

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2874

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RBBP9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000971801 – 186Putative hydrolase RBBP9Add BLAST186

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei49Phosphothreonine; by CK2Sequence analysis1
Modified residuei135Phosphoserine; by CK2Sequence analysis1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75884

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75884

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75884

PeptideAtlas

More...
PeptideAtlasi
O75884

PRoteomics IDEntifications database

More...
PRIDEi
O75884

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50241
50242 [O75884-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75884

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75884

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000089050 Expressed in 195 organ(s), highest expression level in nasal cavity epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_RBBP9

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75884 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015830
HPA049005

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TERF2IPQ9NYB02EBI-11310604,EBI-750109

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115964, 4 interactors

Protein interaction database and analysis system

More...
IntActi
O75884, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000336866

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O75884

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75884

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75884

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O75884

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni56 – 70Retinoblastoma protein bindingSequence analysisAdd BLAST15

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RBBP9 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK06 Eukaryota
ENOG411109T LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014861

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231689

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056175

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75884

KEGG Orthology (KO)

More...
KOi
K07002

Identification of Orthologs from Complete Genome Data

More...
OMAi
ANWYGWL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0MJ3

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75884

TreeFam database of animal gene trees

More...
TreeFami
TF106470

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1820, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029058 AB_hydrolase
IPR010662 Hydrolase_RBBP9/YdeN

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06821 Ser_hydrolase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53474 SSF53474, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75884-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPSKAVIV PGNGGGDVTT HGWYGWVKKE LEKIPGFQCL AKNMPDPITA
60 70 80 90 100
RESIWLPFME TELHCDEKTI IIGHSSGAIA AMRYAETHRV YAIVLVSAYT
110 120 130 140 150
SDLGDENERA SGYFTRPWQW EKIKANCPYI VQFGSTDDPF LPWKEQQEVA
160 170 180
DRLETKLHKF TDCGHFQNTE FHELITVVKS LLKVPA
Length:186
Mass (Da):21,000
Last modified:September 26, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF645E159DCB759BF
GO
Isoform 2 (identifier: O75884-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     152-186: RLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA → SWTPNCTNSLTVVTFRTQSSMN

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,394
Checksum:i4BA65444A2BD291D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2A → V in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti13 – 14NG → KI in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti18V → E in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti93 – 94IV → LI in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti102 – 103DL → EF in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti115T → S in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti129Y → H in AAC63498 (PubMed:9697699).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_004374152 – 186RLETK…LKVPA → SWTPNCTNSLTVVTFRTQSS MN in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF039564 mRNA Translation: AAC63498.1
AF237576 mRNA Translation: AAL83721.1
AL832411 mRNA Translation: CAI46193.1
AL121893 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10236.1
CH471133 Genomic DNA Translation: EAX10237.1
CH471133 Genomic DNA Translation: EAX10238.1
BC015938 mRNA Translation: AAH15938.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13136.1 [O75884-1]

NCBI Reference Sequences

More...
RefSeqi
NP_006597.2, NM_006606.2 [O75884-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.69330

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000337227; ENSP00000336866; ENSG00000089050 [O75884-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10741

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10741

UCSC genome browser

More...
UCSCi
uc002wqy.5 human [O75884-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF039564 mRNA Translation: AAC63498.1
AF237576 mRNA Translation: AAL83721.1
AL832411 mRNA Translation: CAI46193.1
AL121893 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10236.1
CH471133 Genomic DNA Translation: EAX10237.1
CH471133 Genomic DNA Translation: EAX10238.1
BC015938 mRNA Translation: AAH15938.1
CCDSiCCDS13136.1 [O75884-1]
RefSeqiNP_006597.2, NM_006606.2 [O75884-1]
UniGeneiHs.69330

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2QS9X-ray1.72A/B1-186[»]
ProteinModelPortaliO75884
SMRiO75884
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115964, 4 interactors
IntActiO75884, 2 interactors
STRINGi9606.ENSP00000336866

Chemistry databases

BindingDBiO75884
ChEMBLiCHEMBL1075121
GuidetoPHARMACOLOGYi2874

Protein family/group databases

ESTHERihuman-RBBP9 Hydrolase_RBBP9_YdeN

PTM databases

iPTMnetiO75884
PhosphoSitePlusiO75884

Polymorphism and mutation databases

BioMutaiRBBP9

Proteomic databases

EPDiO75884
MaxQBiO75884
PaxDbiO75884
PeptideAtlasiO75884
PRIDEiO75884
ProteomicsDBi50241
50242 [O75884-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10741
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337227; ENSP00000336866; ENSG00000089050 [O75884-1]
GeneIDi10741
KEGGihsa:10741
UCSCiuc002wqy.5 human [O75884-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10741
DisGeNETi10741
EuPathDBiHostDB:ENSG00000089050.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RBBP9
HGNCiHGNC:9892 RBBP9
HPAiHPA015830
HPA049005
MIMi602908 gene
neXtProtiNX_O75884
OpenTargetsiENSG00000089050
PharmGKBiPA34256

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IK06 Eukaryota
ENOG411109T LUCA
GeneTreeiENSGT00390000014861
HOGENOMiHOG000231689
HOVERGENiHBG056175
InParanoidiO75884
KOiK07002
OMAiANWYGWL
OrthoDBiEOG091G0MJ3
PhylomeDBiO75884
TreeFamiTF106470

Miscellaneous databases

EvolutionaryTraceiO75884

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RBBP9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10741

Protein Ontology

More...
PROi
PR:O75884

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000089050 Expressed in 195 organ(s), highest expression level in nasal cavity epithelium
CleanExiHS_RBBP9
GenevisibleiO75884 HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR010662 Hydrolase_RBBP9/YdeN
PfamiView protein in Pfam
PF06821 Ser_hydrolase, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBBP9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75884
Secondary accession number(s): D3DW31, Q5JPH9, Q9H1D8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: September 26, 2001
Last modified: September 12, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again