Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative hydrolase RBBP9

Gene

RBBP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.

Miscellaneous

Interacts with the serine hydrolase-directed activity-based probe fluorophosphonate-rhodamine (FP-rhodamine). This interaction is inhibited selectively and reversibly by emetine, a compound with cytotoxic activity.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei75Charge relay systemSequence analysis1
Active sitei138Charge relay systemSequence analysis1
Active sitei165Charge relay systemSequence analysis1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase

Protein family/group databases

ESTHERihuman-RBBP9 Hydrolase_RBBP9_YdeN

Names & Taxonomyi

Protein namesi
Recommended name:
Putative hydrolase RBBP9 (EC:3.-.-.-)
Alternative name(s):
B5T-overexpressed gene protein
Short name:
Protein BOG
Retinoblastoma-binding protein 10
Short name:
RBBP-10
Retinoblastoma-binding protein 9
Short name:
RBBP-9
Gene namesi
Name:RBBP9
Synonyms:BOG, RBBP10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000089050.14
HGNCiHGNC:9892 RBBP9
MIMi602908 gene
neXtProtiNX_O75884

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi63L → Q: Loss of retinoblastoma protein binding. 1 Publication1

Organism-specific databases

DisGeNETi10741
OpenTargetsiENSG00000089050
PharmGKBiPA34256

Chemistry databases

ChEMBLiCHEMBL1075121
GuidetoPHARMACOLOGYi2874

Polymorphism and mutation databases

BioMutaiRBBP9

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000971801 – 186Putative hydrolase RBBP9Add BLAST186

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei49Phosphothreonine; by CK2Sequence analysis1
Modified residuei135Phosphoserine; by CK2Sequence analysis1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO75884
MaxQBiO75884
PaxDbiO75884
PeptideAtlasiO75884
PRIDEiO75884
ProteomicsDBi50241
50242 [O75884-2]

PTM databases

iPTMnetiO75884
PhosphoSitePlusiO75884

Expressioni

Tissue specificityi

Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.

Gene expression databases

BgeeiENSG00000089050 Expressed in 195 organ(s), highest expression level in nasal cavity epithelium
CleanExiHS_RBBP9
GenevisibleiO75884 HS

Organism-specific databases

HPAiHPA015830
HPA049005

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TERF2IPQ9NYB02EBI-11310604,EBI-750109

Protein-protein interaction databases

BioGridi115964, 4 interactors
IntActiO75884, 2 interactors
STRINGi9606.ENSP00000336866

Chemistry databases

BindingDBiO75884

Structurei

Secondary structure

1186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75884
SMRiO75884
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75884

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni56 – 70Retinoblastoma protein bindingSequence analysisAdd BLAST15

Sequence similaritiesi

Belongs to the RBBP9 family.Curated

Phylogenomic databases

eggNOGiENOG410IK06 Eukaryota
ENOG411109T LUCA
GeneTreeiENSGT00390000014861
HOGENOMiHOG000231689
HOVERGENiHBG056175
InParanoidiO75884
KOiK07002
OMAiANWYGWL
OrthoDBiEOG091G0MJ3
PhylomeDBiO75884
TreeFamiTF106470

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR010662 Hydrolase_RBBP9/YdeN
PfamiView protein in Pfam
PF06821 Ser_hydrolase, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75884-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPSKAVIV PGNGGGDVTT HGWYGWVKKE LEKIPGFQCL AKNMPDPITA
60 70 80 90 100
RESIWLPFME TELHCDEKTI IIGHSSGAIA AMRYAETHRV YAIVLVSAYT
110 120 130 140 150
SDLGDENERA SGYFTRPWQW EKIKANCPYI VQFGSTDDPF LPWKEQQEVA
160 170 180
DRLETKLHKF TDCGHFQNTE FHELITVVKS LLKVPA
Length:186
Mass (Da):21,000
Last modified:September 26, 2001 - v2
Checksum:iF645E159DCB759BF
GO
Isoform 2 (identifier: O75884-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     152-186: RLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA → SWTPNCTNSLTVVTFRTQSSMN

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,394
Checksum:i4BA65444A2BD291D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2A → V in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti13 – 14NG → KI in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti18V → E in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti93 – 94IV → LI in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti102 – 103DL → EF in AAC63498 (PubMed:9697699).Curated2
Sequence conflicti115T → S in AAC63498 (PubMed:9697699).Curated1
Sequence conflicti129Y → H in AAC63498 (PubMed:9697699).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_004374152 – 186RLETK…LKVPA → SWTPNCTNSLTVVTFRTQSS MN in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF039564 mRNA Translation: AAC63498.1
AF237576 mRNA Translation: AAL83721.1
AL832411 mRNA Translation: CAI46193.1
AL121893 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10236.1
CH471133 Genomic DNA Translation: EAX10237.1
CH471133 Genomic DNA Translation: EAX10238.1
BC015938 mRNA Translation: AAH15938.1
CCDSiCCDS13136.1 [O75884-1]
RefSeqiNP_006597.2, NM_006606.2 [O75884-1]
UniGeneiHs.69330

Genome annotation databases

EnsembliENST00000337227; ENSP00000336866; ENSG00000089050 [O75884-1]
GeneIDi10741
KEGGihsa:10741
UCSCiuc002wqy.5 human [O75884-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRBBP9_HUMAN
AccessioniPrimary (citable) accession number: O75884
Secondary accession number(s): D3DW31, Q5JPH9, Q9H1D8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: September 26, 2001
Last modified: September 12, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again