Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Krueppel-like factor 7

Gene

KLF7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O75840

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Krueppel-like factor 7
Alternative name(s):
Ubiquitous krueppel-like factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLF7
Synonyms:UKLF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000118263.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6350 KLF7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604865 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75840

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8609

Open Targets

More...
OpenTargetsi
ENSG00000118263

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30140

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471741 – 302Krueppel-like factor 7Add BLAST302

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75840

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75840

PeptideAtlas

More...
PeptideAtlasi
O75840

PRoteomics IDEntifications database

More...
PRIDEi
O75840

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50223

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75840

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75840

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118263 Expressed in 232 organ(s), highest expression level in forebrain

CleanEx database of gene expression profiles

More...
CleanExi
HS_KLF7

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75840 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75840 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030490

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114168, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000309570

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75840

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75840

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi215 – 220Nuclear localization signalSequence analysis6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155235

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231192

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000836

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75840

KEGG Orthology (KO)

More...
KOi
K09207

Identification of Orthologs from Complete Genome Data

More...
OMAi
DLDCFLR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G1BN0

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75840

TreeFam database of animal gene trees

More...
TreeFami
TF350556

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75840-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI
60 70 80 90 100
SETFGEDLDC FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS
110 120 130 140 150
RDKLLSETCL SLQPASSSLD SYTAVNQAQL NAVTSLTPPS SPELSRHLVK
160 170 180 190 200
TSQTLSAVDG TVTLKLVAKK AALSSVKVGG VATAAAAVTA AGAVKSGQSD
210 220 230 240 250
SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ RTHTGEKPYK
260 270 280 290 300
CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR

HI
Length:302
Mass (Da):33,362
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i95141CE3A42C5774
GO
Isoform 2 (identifier: O75840-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M

Show »
Length:269
Mass (Da):29,564
Checksum:iDE6EE837FCE04A5F
GO
Isoform 3 (identifier: O75840-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST

Show »
Length:230
Mass (Da):24,791
Checksum:iDFAB0453E5564923
GO
Isoform 4 (identifier: O75840-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP

Show »
Length:274
Mass (Da):30,178
Checksum:i8EABCFD4A70D4A2F
GO
Isoform 5 (identifier: O75840-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-244: Missing.

Show »
Length:112
Mass (Da):13,444
Checksum:i261E2F7A6F586A33
GO
Isoform 6 (identifier: O75840-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
     88-302: Missing.

Show »
Length:87
Mass (Da):9,295
Checksum:i6C032F59FE36958F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EUU0E7EUU0_HUMAN
Krueppel-like factor 7
KLF7
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JX20C9JX20_HUMAN
Krueppel-like factor 7
KLF7
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EQY2E7EQY2_HUMAN
Krueppel-like factor 7
KLF7
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PHC9E9PHC9_HUMAN
Krueppel-like factor 7
KLF7
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0470301 – 34MDVLA…ETWQQ → M in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0470311 – 34MDVLA…ETWQQ → MFPSWP in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04747735 – 87TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_04747855 – 244Missing in isoform 5. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_04747988 – 302Missing in isoform 6. 1 PublicationAdd BLAST215
Alternative sequenceiVSP_047032179 – 302GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3. 1 PublicationAdd BLAST124

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB015132 mRNA Translation: BAA33521.1
HF546205 mRNA Translation: CCO02791.1
HF546206 mRNA Translation: CCO02792.1
BX537890 mRNA Translation: CAD97885.1
CR542112 mRNA Translation: CAG46909.1
AK297312 mRNA Translation: BAH12543.1
AK314439 mRNA Translation: BAG37050.1
AC007879 Genomic DNA No translation available.
AC008062 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70400.1
CH471063 Genomic DNA Translation: EAW70402.1
CH471063 Genomic DNA Translation: EAW70403.1
BC012919 mRNA Translation: AAH12919.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2373.1 [O75840-1]
CCDS59438.1 [O75840-4]
CCDS59439.1 [O75840-3]
CCDS59440.1 [O75840-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001257871.1, NM_001270942.1 [O75840-3]
NP_001257872.1, NM_001270943.1 [O75840-2]
NP_001257873.1, NM_001270944.1 [O75840-4]
NP_003700.1, NM_003709.3 [O75840-1]
XP_016860650.1, XM_017005161.1 [O75840-1]
XP_016860653.1, XM_017005164.1 [O75840-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.471221
Hs.59908

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309446; ENSP00000309570; ENSG00000118263 [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263 [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263 [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263 [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263 [O75840-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8609

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8609

UCSC genome browser

More...
UCSCi
uc002vbz.3 human [O75840-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA Translation: BAA33521.1
HF546205 mRNA Translation: CCO02791.1
HF546206 mRNA Translation: CCO02792.1
BX537890 mRNA Translation: CAD97885.1
CR542112 mRNA Translation: CAG46909.1
AK297312 mRNA Translation: BAH12543.1
AK314439 mRNA Translation: BAG37050.1
AC007879 Genomic DNA No translation available.
AC008062 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70400.1
CH471063 Genomic DNA Translation: EAW70402.1
CH471063 Genomic DNA Translation: EAW70403.1
BC012919 mRNA Translation: AAH12919.1
CCDSiCCDS2373.1 [O75840-1]
CCDS59438.1 [O75840-4]
CCDS59439.1 [O75840-3]
CCDS59440.1 [O75840-2]
RefSeqiNP_001257871.1, NM_001270942.1 [O75840-3]
NP_001257872.1, NM_001270943.1 [O75840-2]
NP_001257873.1, NM_001270944.1 [O75840-4]
NP_003700.1, NM_003709.3 [O75840-1]
XP_016860650.1, XM_017005161.1 [O75840-1]
XP_016860653.1, XM_017005164.1 [O75840-3]
UniGeneiHs.471221
Hs.59908

3D structure databases

ProteinModelPortaliO75840
SMRiO75840
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114168, 3 interactors
STRINGi9606.ENSP00000309570

PTM databases

iPTMnetiO75840
PhosphoSitePlusiO75840

Proteomic databases

MaxQBiO75840
PaxDbiO75840
PeptideAtlasiO75840
PRIDEiO75840
ProteomicsDBi50223

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8609
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263 [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263 [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263 [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263 [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263 [O75840-5]
GeneIDi8609
KEGGihsa:8609
UCSCiuc002vbz.3 human [O75840-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8609
DisGeNETi8609
EuPathDBiHostDB:ENSG00000118263.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KLF7
HGNCiHGNC:6350 KLF7
HPAiHPA030490
MIMi604865 gene
neXtProtiNX_O75840
OpenTargetsiENSG00000118263
PharmGKBiPA30140

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000155235
HOGENOMiHOG000231192
HOVERGENiHBG000836
InParanoidiO75840
KOiK09207
OMAiDLDCFLR
OrthoDBiEOG091G1BN0
PhylomeDBiO75840
TreeFamiTF350556

Enzyme and pathway databases

SIGNORiO75840

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KLF7 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KLF7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8609

Protein Ontology

More...
PROi
PR:O75840

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000118263 Expressed in 232 organ(s), highest expression level in forebrain
CleanExiHS_KLF7
ExpressionAtlasiO75840 baseline and differential
GenevisibleiO75840 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLF7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75840
Secondary accession number(s): B2RB03
, B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: December 5, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again