Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Krueppel-like factor 7

Gene

KLF7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNORiO75840

Names & Taxonomyi

Protein namesi
Recommended name:
Krueppel-like factor 7
Alternative name(s):
Ubiquitous krueppel-like factor
Gene namesi
Name:KLF7
Synonyms:UKLF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000118263.14
HGNCiHGNC:6350 KLF7
MIMi604865 gene
neXtProtiNX_O75840

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8609
OpenTargetsiENSG00000118263
PharmGKBiPA30140

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000471741 – 302Krueppel-like factor 7Add BLAST302

Proteomic databases

MaxQBiO75840
PaxDbiO75840
PeptideAtlasiO75840
PRIDEiO75840
ProteomicsDBi50223

PTM databases

iPTMnetiO75840
PhosphoSitePlusiO75840

Expressioni

Tissue specificityi

Ubiquitous and highly expressed in brain and spinal cord in the adult, and in kidney and brain in the embryo.

Gene expression databases

BgeeiENSG00000118263 Expressed in 232 organ(s), highest expression level in forebrain
CleanExiHS_KLF7
ExpressionAtlasiO75840 baseline and differential
GenevisibleiO75840 HS

Organism-specific databases

HPAiHPA030490

Interactioni

Protein-protein interaction databases

BioGridi114168, 3 interactors
STRINGi9606.ENSP00000309570

Structurei

3D structure databases

ProteinModelPortaliO75840
SMRiO75840
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi215 – 220Nuclear localization signalSequence analysis6

Domaini

The acidic N-terminal part may favor interaction with the basic domain of transcription factors.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri219 – 243C2H2-type 1PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri249 – 273C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri279 – 301C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118998
HOGENOMiHOG000231192
HOVERGENiHBG000836
InParanoidiO75840
KOiK09207
OMAiDLDCFLR
OrthoDBiEOG091G1BN0
PhylomeDBiO75840
TreeFamiTF350556

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75840-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVLASYSIF QELQLVHDTG YFSALPSLEE TWQQTCLELE RYLQTEPRRI
60 70 80 90 100
SETFGEDLDC FLHASPPPCI EESFRRLDPL LLPVEAAICE KSSAVDILLS
110 120 130 140 150
RDKLLSETCL SLQPASSSLD SYTAVNQAQL NAVTSLTPPS SPELSRHLVK
160 170 180 190 200
TSQTLSAVDG TVTLKLVAKK AALSSVKVGG VATAAAAVTA AGAVKSGQSD
210 220 230 240 250
SDQGGLGAEA CPENKKRVHR CQFNGCRKVY TKSSHLKAHQ RTHTGEKPYK
260 270 280 290 300
CSWEGCEWRF ARSDELTRHY RKHTGAKPFK CNHCDRCFSR SDHLALHMKR

HI
Length:302
Mass (Da):33,362
Last modified:November 1, 1998 - v1
Checksum:i95141CE3A42C5774
GO
Isoform 2 (identifier: O75840-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → M

Show »
Length:269
Mass (Da):29,564
Checksum:iDE6EE837FCE04A5F
GO
Isoform 3 (identifier: O75840-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-302: GGVATAAAAV...HLALHMKRHI → RSLISAHGRD...FPGLTILPST

Show »
Length:230
Mass (Da):24,791
Checksum:iDFAB0453E5564923
GO
Isoform 4 (identifier: O75840-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQ → MFPSWP

Show »
Length:274
Mass (Da):30,178
Checksum:i8EABCFD4A70D4A2F
GO
Isoform 5 (identifier: O75840-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-244: Missing.

Show »
Length:112
Mass (Da):13,444
Checksum:i261E2F7A6F586A33
GO
Isoform 6 (identifier: O75840-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-87: TCLELERYLQ...DPLLLPVEAA → VRSLISAHGR...FPGLTILPST
     88-302: Missing.

Show »
Length:87
Mass (Da):9,295
Checksum:i6C032F59FE36958F
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JX20C9JX20_HUMAN
Krueppel-like factor 7
KLF7
175Annotation score:
E7EUU0E7EUU0_HUMAN
Krueppel-like factor 7
KLF7
60Annotation score:
E7EQY2E7EQY2_HUMAN
Krueppel-like factor 7
KLF7
112Annotation score:
E9PHC9E9PHC9_HUMAN
Krueppel-like factor 7
KLF7
51Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470301 – 34MDVLA…ETWQQ → M in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_0470311 – 34MDVLA…ETWQQ → MFPSWP in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04747735 – 87TCLEL…PVEAA → VRSLISAHGRDVSGVLHEAM SSRGTTGNTQVQSPSNATTA TGVFPGLTILPST in isoform 6. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_04747855 – 244Missing in isoform 5. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_04747988 – 302Missing in isoform 6. 1 PublicationAdd BLAST215
Alternative sequenceiVSP_047032179 – 302GGVAT…MKRHI → RSLISAHGRDVSGVLHEAMS SRGTTGNTQVQSPSNATTAT GVFPGLTILPST in isoform 3. 1 PublicationAdd BLAST124

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA Translation: BAA33521.1
HF546205 mRNA Translation: CCO02791.1
HF546206 mRNA Translation: CCO02792.1
BX537890 mRNA Translation: CAD97885.1
CR542112 mRNA Translation: CAG46909.1
AK297312 mRNA Translation: BAH12543.1
AK314439 mRNA Translation: BAG37050.1
AC007879 Genomic DNA No translation available.
AC008062 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70400.1
CH471063 Genomic DNA Translation: EAW70402.1
CH471063 Genomic DNA Translation: EAW70403.1
BC012919 mRNA Translation: AAH12919.1
CCDSiCCDS2373.1 [O75840-1]
CCDS59438.1 [O75840-4]
CCDS59439.1 [O75840-3]
CCDS59440.1 [O75840-2]
RefSeqiNP_001257871.1, NM_001270942.1 [O75840-3]
NP_001257872.1, NM_001270943.1 [O75840-2]
NP_001257873.1, NM_001270944.1 [O75840-4]
NP_003700.1, NM_003709.3 [O75840-1]
XP_016860650.1, XM_017005161.1 [O75840-1]
XP_016860653.1, XM_017005164.1 [O75840-3]
UniGeneiHs.471221
Hs.59908

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263 [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263 [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263 [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263 [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263 [O75840-5]
GeneIDi8609
KEGGihsa:8609
UCSCiuc002vbz.3 human [O75840-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015132 mRNA Translation: BAA33521.1
HF546205 mRNA Translation: CCO02791.1
HF546206 mRNA Translation: CCO02792.1
BX537890 mRNA Translation: CAD97885.1
CR542112 mRNA Translation: CAG46909.1
AK297312 mRNA Translation: BAH12543.1
AK314439 mRNA Translation: BAG37050.1
AC007879 Genomic DNA No translation available.
AC008062 Genomic DNA No translation available.
CH471063 Genomic DNA Translation: EAW70400.1
CH471063 Genomic DNA Translation: EAW70402.1
CH471063 Genomic DNA Translation: EAW70403.1
BC012919 mRNA Translation: AAH12919.1
CCDSiCCDS2373.1 [O75840-1]
CCDS59438.1 [O75840-4]
CCDS59439.1 [O75840-3]
CCDS59440.1 [O75840-2]
RefSeqiNP_001257871.1, NM_001270942.1 [O75840-3]
NP_001257872.1, NM_001270943.1 [O75840-2]
NP_001257873.1, NM_001270944.1 [O75840-4]
NP_003700.1, NM_003709.3 [O75840-1]
XP_016860650.1, XM_017005161.1 [O75840-1]
XP_016860653.1, XM_017005164.1 [O75840-3]
UniGeneiHs.471221
Hs.59908

3D structure databases

ProteinModelPortaliO75840
SMRiO75840
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114168, 3 interactors
STRINGi9606.ENSP00000309570

PTM databases

iPTMnetiO75840
PhosphoSitePlusiO75840

Proteomic databases

MaxQBiO75840
PaxDbiO75840
PeptideAtlasiO75840
PRIDEiO75840
ProteomicsDBi50223

Protocols and materials databases

DNASUi8609
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309446; ENSP00000309570; ENSG00000118263 [O75840-1]
ENST00000412414; ENSP00000403284; ENSG00000118263 [O75840-4]
ENST00000421199; ENSP00000387510; ENSG00000118263 [O75840-2]
ENST00000423015; ENSP00000398572; ENSG00000118263 [O75840-3]
ENST00000458272; ENSP00000393268; ENSG00000118263 [O75840-5]
GeneIDi8609
KEGGihsa:8609
UCSCiuc002vbz.3 human [O75840-1]

Organism-specific databases

CTDi8609
DisGeNETi8609
EuPathDBiHostDB:ENSG00000118263.14
GeneCardsiKLF7
HGNCiHGNC:6350 KLF7
HPAiHPA030490
MIMi604865 gene
neXtProtiNX_O75840
OpenTargetsiENSG00000118263
PharmGKBiPA30140
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118998
HOGENOMiHOG000231192
HOVERGENiHBG000836
InParanoidiO75840
KOiK09207
OMAiDLDCFLR
OrthoDBiEOG091G1BN0
PhylomeDBiO75840
TreeFamiTF350556

Enzyme and pathway databases

SIGNORiO75840

Miscellaneous databases

ChiTaRSiKLF7 human
GeneWikiiKLF7
GenomeRNAii8609
PROiPR:O75840
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118263 Expressed in 232 organ(s), highest expression level in forebrain
CleanExiHS_KLF7
ExpressionAtlasiO75840 baseline and differential
GenevisibleiO75840 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiKLF7_HUMAN
AccessioniPrimary (citable) accession number: O75840
Secondary accession number(s): B2RB03
, B7Z4F7, C9JF04, E7EWH1, L0R4P2, Q7Z3H8, Q96E51
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: November 7, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again