Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger MYND domain-containing protein 10

Gene

ZMYND10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in axonemal structure organization and motility (PubMed:23891469, PubMed:23891471). Involved in axonemal pre-assembly of inner and outer dynein arms (IDA and ODA, respectively) for proper axoneme building for cilia motility (By similarity). May act by indirectly regulating transcription of dynein proteins (By similarity).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri394 – 430MYND-typePROSITE-ProRule annotationAdd BLAST37

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger MYND domain-containing protein 10Curated
Alternative name(s):
Protein BLu1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZMYND10Imported
Synonyms:BLU1 Publication
ORF Names:LUCA12.4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000004838.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19412 ZMYND10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607070 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75800

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ciliary dyskinesia, primary, 22 (CILD22)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia. Patients may exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome.
See also OMIM:615444
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07018416V → G in CILD22; no loss of interaction with LRRC6. 2 PublicationsCorresponds to variant dbSNP:rs138815960EnsemblClinVar.1
Natural variantiVAR_07018529S → P in CILD22; no loss of interaction with LRRC6. 1 PublicationCorresponds to variant dbSNP:rs587621539EnsemblClinVar.1
Natural variantiVAR_07018639L → P in CILD22. 1 Publication1
Natural variantiVAR_070187266L → P in CILD22. 1 PublicationCorresponds to variant dbSNP:rs200913791EnsemblClinVar.1
Natural variantiVAR_080482323 – 440Missing in CILD22; loss of interaction with LRRC6. 1 PublicationAdd BLAST118
Natural variantiVAR_080483366 – 440Missing in CILD22; loss of interaction with DNAL1. 2 PublicationsAdd BLAST75
Natural variantiVAR_070189379Y → C in CILD22; no loss of interaction with LRRC6. 1 PublicationCorresponds to variant dbSNP:rs753061612Ensembl.1

Keywords - Diseasei

Ciliopathy, Disease mutation, Kartagener syndrome, Primary ciliary dyskinesia

Organism-specific databases

DisGeNET

More...
DisGeNETi
51364

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
ZMYND10

MalaCards human disease database

More...
MalaCardsi
ZMYND10
MIMi615444 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000004838

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
244 Primary ciliary dyskinesia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134981649

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZMYND10

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002183141 – 440Zinc finger MYND domain-containing protein 10Add BLAST440

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75800

PeptideAtlas

More...
PeptideAtlasi
O75800

PRoteomics IDEntifications database

More...
PRIDEi
O75800

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50200
50201 [O75800-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75800

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75800

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000004838 Expressed in 102 organ(s), highest expression level in left testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_ZMYND10

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75800 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75800 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035255

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with LRRC6 (via CS domain); this interaction stabilizes LRRC6 at the protein level (PubMed:23891469, PubMed:23891471, PubMed:29601588). Interacts (via C-terminus) with DNAL1; this interaction stabilizes DNAL1 at the protein level (PubMed:29601588). Interacts with DNAAF4, HSPA8, IQUB, RUVBL2 and TCTEX1D1 (PubMed:29601588).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119499, 11 interactors

Protein interaction database and analysis system

More...
IntActi
O75800, 18 interactors

Molecular INTeraction database

More...
MINTi
O75800

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000231749

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1440
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D8QNMR-A384-440[»]
2DANNMR-A384-430[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75800

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75800

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O75800

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni366 – 440Interaction with LRRC6Add BLAST75

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ZMYND10 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri394 – 430MYND-typePROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIFT Eukaryota
ENOG410Z083 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153820

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007333

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055814

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75800

Identification of Orthologs from Complete Genome Data

More...
OMAi
IYKIGLR

Database of Orthologous Groups

More...
OrthoDBi
685805at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75800

TreeFam database of animal gene trees

More...
TreeFami
TF324215

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017333 UCP037948_Znf-MYND
IPR002893 Znf_MYND

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01753 zf-MYND, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037948 UCP037948_Znf_MYND10, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75800-1) [UniParc]FASTAAdd to basket
Also known as: Lung

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDLELLLPG EAEVLVRGLR SFPLREMGSE GWNQQHENLE KLNMQAILDA
60 70 80 90 100
TVSQGEPIQE LLVTHGKVPT LVEELIAVEM WKQKVFPVFC RVEDFKPQNT
110 120 130 140 150
FPIYMVVHHE ASIINLLETV FFHKEVCESA EDTVLDLVDY CHRKLTLLVA
160 170 180 190 200
QSGCGGPPEG EGSQDSNPMQ ELQKQAELME FEIALKALSV LRYITDCVDS
210 220 230 240 250
LSLSTLSRML STHNLPCLLV ELLEHSPWSR REGGKLQQFE GSRWHTVAPS
260 270 280 290 300
EQQKLSKLDG QVWIALYNLL LSPEAQARYC LTSFAKGRLL KLRAFLTDTL
310 320 330 340 350
LDQLPNLAHL QSFLAHLTLT ETQPPKKDLV LEQIPEIWER LERENRGKWQ
360 370 380 390 400
AIAKHQLQHV FSPSEQDLRL QARRWAETYR LDVLEAVAPE RPRCAYCSAE
410 420 430 440
ASKRCSRCQN EWYCCRECQV KHWEKHGKTC VLAAQGDRAK
Length:440
Mass (Da):50,344
Last modified:November 8, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i510D41074C956CA3
GO
Isoform 2 (identifier: O75800-2) [UniParc]FASTAAdd to basket
Also known as: Testis

The sequence of this isoform differs from the canonical sequence as follows:
     200-234: SLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGG → RQWSVSQPPQLAHLKRIQRLHPVCWFLSPG

Show »
Length:435
Mass (Da):49,989
Checksum:i8E4A85DD7782C5D3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JUQ8C9JUQ8_HUMAN
Zinc finger MYND domain-containing ...
ZMYND10
282Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3M9F2Z3M9_HUMAN
Zinc finger MYND domain-containing ...
ZMYND10
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB67311 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti35Q → R in CAD38688 (PubMed:17974005).Curated1
Sequence conflicti82K → E in BAG53316 (PubMed:14702039).Curated1
Sequence conflicti134V → A in BAD97063 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07018416V → G in CILD22; no loss of interaction with LRRC6. 2 PublicationsCorresponds to variant dbSNP:rs138815960EnsemblClinVar.1
Natural variantiVAR_07018529S → P in CILD22; no loss of interaction with LRRC6. 1 PublicationCorresponds to variant dbSNP:rs587621539EnsemblClinVar.1
Natural variantiVAR_07018639L → P in CILD22. 1 Publication1
Natural variantiVAR_070187266L → P in CILD22. 1 PublicationCorresponds to variant dbSNP:rs200913791EnsemblClinVar.1
Natural variantiVAR_080482323 – 440Missing in CILD22; loss of interaction with LRRC6. 1 PublicationAdd BLAST118
Natural variantiVAR_080483366 – 440Missing in CILD22; loss of interaction with DNAL1. 2 PublicationsAdd BLAST75
Natural variantiVAR_070188369R → W1 PublicationCorresponds to variant dbSNP:rs142613783EnsemblClinVar.1
Natural variantiVAR_070189379Y → C in CILD22; no loss of interaction with LRRC6. 1 PublicationCorresponds to variant dbSNP:rs753061612Ensembl.1
Natural variantiVAR_014227407R → Q in non-small cell lung cancer cell lines. 1 PublicationCorresponds to variant dbSNP:rs182064110Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003328200 – 234SLSLS…RREGG → RQWSVSQPPQLAHLKRIQRL HPVCWFLSPG in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U70824 mRNA Translation: AAC24726.1
U70880 mRNA Translation: AAC24728.1
AL833828 mRNA Translation: CAD38688.1
AK096525 mRNA Translation: BAG53316.1
AK223343 mRNA Translation: BAD97063.1
AC002481 Genomic DNA Translation: AAB67311.1 Sequence problems.
CH471055 Genomic DNA Translation: EAW65104.1
BC033732 mRNA Translation: AAH33732.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2825.1 [O75800-1]
CCDS77747.1 [O75800-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001295308.1, NM_001308379.1 [O75800-2]
NP_056980.2, NM_015896.3 [O75800-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.526735
Hs.627171

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000231749; ENSP00000231749; ENSG00000004838 [O75800-1]
ENST00000360165; ENSP00000353289; ENSG00000004838 [O75800-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51364

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51364

UCSC genome browser

More...
UCSCi
uc003dag.2 human [O75800-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70824 mRNA Translation: AAC24726.1
U70880 mRNA Translation: AAC24728.1
AL833828 mRNA Translation: CAD38688.1
AK096525 mRNA Translation: BAG53316.1
AK223343 mRNA Translation: BAD97063.1
AC002481 Genomic DNA Translation: AAB67311.1 Sequence problems.
CH471055 Genomic DNA Translation: EAW65104.1
BC033732 mRNA Translation: AAH33732.1
CCDSiCCDS2825.1 [O75800-1]
CCDS77747.1 [O75800-2]
RefSeqiNP_001295308.1, NM_001308379.1 [O75800-2]
NP_056980.2, NM_015896.3 [O75800-1]
UniGeneiHs.526735
Hs.627171

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D8QNMR-A384-440[»]
2DANNMR-A384-430[»]
ProteinModelPortaliO75800
SMRiO75800
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119499, 11 interactors
IntActiO75800, 18 interactors
MINTiO75800
STRINGi9606.ENSP00000231749

PTM databases

iPTMnetiO75800
PhosphoSitePlusiO75800

Polymorphism and mutation databases

BioMutaiZMYND10

Proteomic databases

PaxDbiO75800
PeptideAtlasiO75800
PRIDEiO75800
ProteomicsDBi50200
50201 [O75800-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51364
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000231749; ENSP00000231749; ENSG00000004838 [O75800-1]
ENST00000360165; ENSP00000353289; ENSG00000004838 [O75800-2]
GeneIDi51364
KEGGihsa:51364
UCSCiuc003dag.2 human [O75800-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51364
DisGeNETi51364
EuPathDBiHostDB:ENSG00000004838.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZMYND10
GeneReviewsiZMYND10
HGNCiHGNC:19412 ZMYND10
HPAiHPA035255
MalaCardsiZMYND10
MIMi607070 gene
615444 phenotype
neXtProtiNX_O75800
OpenTargetsiENSG00000004838
Orphaneti244 Primary ciliary dyskinesia
PharmGKBiPA134981649

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIFT Eukaryota
ENOG410Z083 LUCA
GeneTreeiENSGT00940000153820
HOGENOMiHOG000007333
HOVERGENiHBG055814
InParanoidiO75800
OMAiIYKIGLR
OrthoDBi685805at2759
PhylomeDBiO75800
TreeFamiTF324215

Miscellaneous databases

EvolutionaryTraceiO75800

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZMYND10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51364

Protein Ontology

More...
PROi
PR:O75800

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000004838 Expressed in 102 organ(s), highest expression level in left testis
CleanExiHS_ZMYND10
ExpressionAtlasiO75800 baseline and differential
GenevisibleiO75800 HS

Family and domain databases

InterProiView protein in InterPro
IPR017333 UCP037948_Znf-MYND
IPR002893 Znf_MYND
PfamiView protein in Pfam
PF01753 zf-MYND, 1 hit
PIRSFiPIRSF037948 UCP037948_Znf_MYND10, 1 hit
PROSITEiView protein in PROSITE
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZMY10_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75800
Secondary accession number(s): A6NK41
, B3KU54, O14570, O75801, Q53FE6, Q8N4R6, Q8NDN6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 8, 2002
Last modified: January 16, 2019
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again