Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA repair protein RAD51 homolog 4

Gene

RAD51D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Bind to single-stranded DNA (ssDNA) and has DNA-dependent ATPase activity. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Involved in telomere maintenance. The BCDX2 subcomplex XRCC2:RAD51D can stimulate Holliday junction resolution by BLM.7 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi107 – 114ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: UniProtKB
  • gamma-tubulin binding Source: UniProtKB
  • single-stranded DNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA recombination, DNA repair
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 4
Alternative name(s):
R51H3
RAD51 homolog D
RAD51-like protein 3
TRAD
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAD51D
Synonyms:RAD51L3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185379.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9823 RAD51D

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602954 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75771

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Cytoskeleton, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Breast-ovarian cancer, familial, 4 (BROVCA4)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate.
See also OMIM:614291

Organism-specific databases

DisGeNET

More...
DisGeNETi
5892

MalaCards human disease database

More...
MalaCardsi
RAD51D
MIMi614291 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000185379

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
145 Hereditary breast and ovarian cancer syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34179

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAD51D

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001229421 – 328DNA repair protein RAD51 homolog 4Add BLAST328

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75771

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75771

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75771

PeptideAtlas

More...
PeptideAtlasi
O75771

PRoteomics IDEntifications database

More...
PRIDEi
O75771

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50183
50184 [O75771-2]
50185 [O75771-3]
50186 [O75771-4]
50187 [O75771-5]
50188 [O75771-6]
50189 [O75771-7]
50190 [O75771-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75771

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75771

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185379 Expressed in 128 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75771 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75771 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. In the absence of DNA, the BCDX2 subcomplex XRCC2:RAD51D formed a multimeric ring structure; in the presence of single-stranded DNA it formed a filamentous structure with the ssDNA. Interacts with SWSAP1 and ZSWIM7; involved in homologous recombination repair. Interacts with BLM; required for stimulation of BLM activity by the BCDX2 subcomplex XRCC2:RAD51D.9 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111829, 41 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O75771

Database of interacting proteins

More...
DIPi
DIP-24265N

Protein interaction database and analysis system

More...
IntActi
O75771, 55 interactors

Molecular INTeraction database

More...
MINTi
O75771

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000466834

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1328
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75771

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75771

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 83preferentially binds ssDNAAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi200 – 205Poly-Val6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1433 Eukaryota
KOG4275 Eukaryota
ENOG41101VR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159095

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049134

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057455

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75771

KEGG Orthology (KO)

More...
KOi
K10871

Identification of Orthologs from Complete Genome Data

More...
OMAi
HVTRDRD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0SEJ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75771

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01123 Rad51_DMC1_radA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08423 Rad51, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005856 Rad51, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50162 RECA_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75771-1) [UniParc]FASTAAdd to basket
Also known as: TRAD

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVLRVGLCP GLTEEMIQLL RSHRIKTVVD LVSADLEEVA QKCGLSYKAL
60 70 80 90 100
VALRRVLLAQ FSAFPVNGAD LYEELKTSTA ILSTGIGSLD KLLDAGLYTG
110 120 130 140 150
EVTEIVGGPG SGKTQVCLCM AANVAHGLQQ NVLYVDSNGG LTASRLLQLL
160 170 180 190 200
QAKTQDEEEQ AEALRRIQVV HAFDIFQMLD VLQELRGTVA QQVTGSSGTV
210 220 230 240 250
KVVVVDSVTA VVSPLLGGQQ REGLALMMQL ARELKTLARD LGMAVVVTNH
260 270 280 290 300
ITRDRDSGRL KPALGRSWSF VPSTRILLDT IEGAGASGGR RMACLAKSSR
310 320
QPTGFQEMVD IGTWGTSEQS ATLQGDQT
Length:328
Mass (Da):35,049
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6038DA9356DF354A
GO
Isoform 2 (identifier: O75771-2) [UniParc]FASTAAdd to basket
Also known as: TRAD-D1, D2

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: A → S
     50-328: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:49
Mass (Da):5,387
Checksum:i0B2D7DC5AF7D3D70
GO
Isoform 3 (identifier: O75771-3) [UniParc]FASTAAdd to basket
Also known as: TRAD-D3

The sequence of this isoform differs from the canonical sequence as follows:
     50-161: Missing.

Show »
Length:216
Mass (Da):23,317
Checksum:i34C5B25933759EC0
GO
Isoform 4 (identifier: O75771-4) [UniParc]FASTAAdd to basket
Also known as: TRAD-D4

The sequence of this isoform differs from the canonical sequence as follows:
     116-160: Missing.

Show »
Length:283
Mass (Da):30,194
Checksum:i77A839A78449DC78
GO
Isoform 5 (identifier: O75771-5) [UniParc]FASTAAdd to basket
Also known as: TRAD-D5

The sequence of this isoform differs from the canonical sequence as follows:
     88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL

Show »
Length:328
Mass (Da):35,214
Checksum:iA494887924CB3834
GO
Isoform 6 (identifier: O75771-6) [UniParc]FASTAAdd to basket
Also known as: TRAD-D6, D7

The sequence of this isoform differs from the canonical sequence as follows:
     88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML
     119-328: Missing.

Show »
Length:118
Mass (Da):12,675
Checksum:iE7A605D379835E0A
GO
Isoform 7 (identifier: O75771-7) [UniParc]FASTAAdd to basket
Also known as: TRAD-D8

The sequence of this isoform differs from the canonical sequence as follows:
     193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC
     213-328: Missing.

Show »
Length:212
Mass (Da):22,975
Checksum:iE2554F3D42E92D58
GO
Isoform 8 (identifier: O75771-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-88: ALVALRRVLL...TAILSTGIGS → TWRAHSSGNL...ERGTAVSTSR

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):37,014
Checksum:i7371C4C9882D629C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN92K7EN92_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
249Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMF1K7EMF1_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESL4K7ESL4_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0UID0H0UID0_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D hCG_1989222
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERM7K7ERM7_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKG7K7EKG7_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJ58K7EJ58_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESI1K7ESI1_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti231A → V in CAB55937 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0792719C → S1 PublicationCorresponds to variant dbSNP:rs140825795EnsemblClinVar.1
Natural variantiVAR_02056024R → S1 PublicationCorresponds to variant dbSNP:rs28363257EnsemblClinVar.1
Natural variantiVAR_020561165R → Q1 PublicationCorresponds to variant dbSNP:rs4796033EnsemblClinVar.1
Natural variantiVAR_020562225A → T1 PublicationCorresponds to variant dbSNP:rs28363282EnsemblClinVar.1
Natural variantiVAR_020563232R → Q1 PublicationCorresponds to variant dbSNP:rs28363283EnsemblClinVar.1
Natural variantiVAR_020564233E → G1 PublicationCorresponds to variant dbSNP:rs28363284EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04365849 – 88ALVAL…TGIGS → TWRAHSSGNLGGLQLPQVPA GRSWSGVRNALKKAGLGHGG TDGLSLNAFDERGTAVSTSR in isoform 8. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_00555849A → S in isoform 2. Curated1
Alternative sequenceiVSP_00555950 – 328Missing in isoform 2. CuratedAdd BLAST279
Alternative sequenceiVSP_00556050 – 161Missing in isoform 3. CuratedAdd BLAST112
Alternative sequenceiVSP_00556388 – 118SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_00556288 – 101SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. CuratedAdd BLAST14
Alternative sequenceiVSP_005561116 – 160Missing in isoform 4. CuratedAdd BLAST45
Alternative sequenceiVSP_005564119 – 328Missing in isoform 6. CuratedAdd BLAST210
Alternative sequenceiVSP_005565193 – 212VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. CuratedAdd BLAST20
Alternative sequenceiVSP_005566213 – 328Missing in isoform 7. CuratedAdd BLAST116

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y15572 mRNA Translation: CAA75681.1
AF034956 mRNA Translation: AAC39719.1
AB013341 mRNA Translation: BAA25914.1
AB016223 mRNA Translation: BAA31747.1
AB016224 mRNA Translation: BAA31748.1
AB016225 mRNA Translation: BAA31749.1
AB018360 mRNA Translation: BAA33779.1
AB018361 mRNA Translation: BAA33780.1
AB018362 mRNA Translation: BAA33781.1
AB018363 mRNA Translation: BAA33782.1
AB020412 mRNA Translation: BAA34690.1
AY623116 Genomic DNA Translation: AAT38112.1
AK296241 mRNA Translation: BAG58959.1
AC022916 Genomic DNA No translation available.
CH471147 Genomic DNA Translation: EAW80181.1
CH471147 Genomic DNA Translation: EAW80184.1
CH471147 Genomic DNA Translation: EAW80196.1
BC014422 mRNA Translation: AAH14422.1
AL117459 mRNA Translation: CAB55937.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11287.1 [O75771-1]
CCDS11288.1 [O75771-3]
CCDS45646.1 [O75771-8]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17247

NCBI Reference Sequences

More...
RefSeqi
NP_001136043.1, NM_001142571.1 [O75771-8]
NP_002869.3, NM_002878.3 [O75771-1]
NP_598332.1, NM_133629.2 [O75771-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.631757

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000335858; ENSP00000338408; ENSG00000185379 [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379 [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379 [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379 [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379 [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379 [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379 [O75771-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5892

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5892

UCSC genome browser

More...
UCSCi
uc002hir.4 human [O75771-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15572 mRNA Translation: CAA75681.1
AF034956 mRNA Translation: AAC39719.1
AB013341 mRNA Translation: BAA25914.1
AB016223 mRNA Translation: BAA31747.1
AB016224 mRNA Translation: BAA31748.1
AB016225 mRNA Translation: BAA31749.1
AB018360 mRNA Translation: BAA33779.1
AB018361 mRNA Translation: BAA33780.1
AB018362 mRNA Translation: BAA33781.1
AB018363 mRNA Translation: BAA33782.1
AB020412 mRNA Translation: BAA34690.1
AY623116 Genomic DNA Translation: AAT38112.1
AK296241 mRNA Translation: BAG58959.1
AC022916 Genomic DNA No translation available.
CH471147 Genomic DNA Translation: EAW80181.1
CH471147 Genomic DNA Translation: EAW80184.1
CH471147 Genomic DNA Translation: EAW80196.1
BC014422 mRNA Translation: AAH14422.1
AL117459 mRNA Translation: CAB55937.1
CCDSiCCDS11287.1 [O75771-1]
CCDS11288.1 [O75771-3]
CCDS45646.1 [O75771-8]
PIRiT17247
RefSeqiNP_001136043.1, NM_001142571.1 [O75771-8]
NP_002869.3, NM_002878.3 [O75771-1]
NP_598332.1, NM_133629.2 [O75771-3]
UniGeneiHs.631757

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ3NMR-A1-83[»]
ProteinModelPortaliO75771
SMRiO75771
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111829, 41 interactors
CORUMiO75771
DIPiDIP-24265N
IntActiO75771, 55 interactors
MINTiO75771
STRINGi9606.ENSP00000466834

PTM databases

iPTMnetiO75771
PhosphoSitePlusiO75771

Polymorphism and mutation databases

BioMutaiRAD51D

Proteomic databases

EPDiO75771
MaxQBiO75771
PaxDbiO75771
PeptideAtlasiO75771
PRIDEiO75771
ProteomicsDBi50183
50184 [O75771-2]
50185 [O75771-3]
50186 [O75771-4]
50187 [O75771-5]
50188 [O75771-6]
50189 [O75771-7]
50190 [O75771-8]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5892
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379 [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379 [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379 [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379 [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379 [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379 [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379 [O75771-8]
GeneIDi5892
KEGGihsa:5892
UCSCiuc002hir.4 human [O75771-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5892
DisGeNETi5892
EuPathDBiHostDB:ENSG00000185379.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAD51D
HGNCiHGNC:9823 RAD51D
MalaCardsiRAD51D
MIMi602954 gene
614291 phenotype
neXtProtiNX_O75771
OpenTargetsiENSG00000185379
Orphaneti145 Hereditary breast and ovarian cancer syndrome
PharmGKBiPA34179

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
KOG4275 Eukaryota
ENOG41101VR LUCA
GeneTreeiENSGT00940000159095
HOGENOMiHOG000049134
HOVERGENiHBG057455
InParanoidiO75771
KOiK10871
OMAiHVTRDRD
OrthoDBiEOG091G0SEJ
PhylomeDBiO75771

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAD51L3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5892

Protein Ontology

More...
PROi
PR:O75771

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185379 Expressed in 128 organ(s), highest expression level in sperm
ExpressionAtlasiO75771 baseline and differential
GenevisibleiO75771 HS

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRA51D_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75771
Secondary accession number(s): B4DJU7
, E1P637, O43537, O60355, O75196, O75847, O75848, O76073, O76085, O94908, Q9UFU5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: December 5, 2018
This is version 181 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again