Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA repair protein RAD51 homolog 4

Gene

RAD51D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. Bind to single-stranded DNA (ssDNA) and has DNA-dependent ATPase activity. Part of the Rad21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Involved in telomere maintenance. The BCDX2 subcomplex XRCC2:RAD51D can stimulate Holliday junction resolution by BLM.7 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi107 – 114ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: UniProtKB
  • gamma-tubulin binding Source: UniProtKB
  • single-stranded DNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA recombination, DNA repair
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes

Names & Taxonomyi

Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 4
Alternative name(s):
R51H3
RAD51 homolog D
RAD51-like protein 3
TRAD
Gene namesi
Name:RAD51D
Synonyms:RAD51L3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000185379.20
HGNCiHGNC:9823 RAD51D
MIMi602954 gene
neXtProtiNX_O75771

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Cytoskeleton, Nucleus, Telomere

Pathology & Biotechi

Involvement in diseasei

Breast-ovarian cancer, familial, 4 (BROVCA4)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate.
See also OMIM:614291

Organism-specific databases

DisGeNETi5892
MalaCardsiRAD51D
MIMi614291 phenotype
OpenTargetsiENSG00000185379
Orphaneti145 Hereditary breast and ovarian cancer syndrome
PharmGKBiPA34179

Polymorphism and mutation databases

BioMutaiRAD51D

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001229421 – 328DNA repair protein RAD51 homolog 4Add BLAST328

Proteomic databases

EPDiO75771
MaxQBiO75771
PaxDbiO75771
PeptideAtlasiO75771
PRIDEiO75771
ProteomicsDBi50183
50184 [O75771-2]
50185 [O75771-3]
50186 [O75771-4]
50187 [O75771-5]
50188 [O75771-6]
50189 [O75771-7]
50190 [O75771-8]

PTM databases

iPTMnetiO75771
PhosphoSitePlusiO75771

Expressioni

Tissue specificityi

Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.

Gene expression databases

BgeeiENSG00000185379 Expressed in 128 organ(s), highest expression level in sperm
ExpressionAtlasiO75771 baseline and differential
GenevisibleiO75771 HS

Interactioni

Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. In the absence of DNA, the BCDX2 subcomplex XRCC2:RAD51D formed a multimeric ring structure; in the presence of single-stranded DNA it formed a filamentous structure with the ssDNA. Interacts with SWSAP1 and ZSWIM7; involved in homologous recombination repair. Interacts with BLM; required for stimulation of BLM activity by the BCDX2 subcomplex XRCC2:RAD51D.9 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111829, 41 interactors
CORUMiO75771
DIPiDIP-24265N
IntActiO75771, 55 interactors
MINTiO75771
STRINGi9606.ENSP00000466834

Structurei

Secondary structure

1328
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75771
SMRiO75771
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 83preferentially binds ssDNAAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi200 – 205Poly-Val6

Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.Curated

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
KOG4275 Eukaryota
ENOG41101VR LUCA
GeneTreeiENSGT00860000133731
HOGENOMiHOG000049134
HOVERGENiHBG057455
InParanoidiO75771
KOiK10871
OMAiHVTRDRD
OrthoDBiEOG091G0SEJ
PhylomeDBiO75771

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75771-1) [UniParc]FASTAAdd to basket
Also known as: TRAD

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVLRVGLCP GLTEEMIQLL RSHRIKTVVD LVSADLEEVA QKCGLSYKAL
60 70 80 90 100
VALRRVLLAQ FSAFPVNGAD LYEELKTSTA ILSTGIGSLD KLLDAGLYTG
110 120 130 140 150
EVTEIVGGPG SGKTQVCLCM AANVAHGLQQ NVLYVDSNGG LTASRLLQLL
160 170 180 190 200
QAKTQDEEEQ AEALRRIQVV HAFDIFQMLD VLQELRGTVA QQVTGSSGTV
210 220 230 240 250
KVVVVDSVTA VVSPLLGGQQ REGLALMMQL ARELKTLARD LGMAVVVTNH
260 270 280 290 300
ITRDRDSGRL KPALGRSWSF VPSTRILLDT IEGAGASGGR RMACLAKSSR
310 320
QPTGFQEMVD IGTWGTSEQS ATLQGDQT
Length:328
Mass (Da):35,049
Last modified:November 1, 1998 - v1
Checksum:i6038DA9356DF354A
GO
Isoform 2 (identifier: O75771-2) [UniParc]FASTAAdd to basket
Also known as: TRAD-D1, D2

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: A → S
     50-328: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:49
Mass (Da):5,387
Checksum:i0B2D7DC5AF7D3D70
GO
Isoform 3 (identifier: O75771-3) [UniParc]FASTAAdd to basket
Also known as: TRAD-D3

The sequence of this isoform differs from the canonical sequence as follows:
     50-161: Missing.

Show »
Length:216
Mass (Da):23,317
Checksum:i34C5B25933759EC0
GO
Isoform 4 (identifier: O75771-4) [UniParc]FASTAAdd to basket
Also known as: TRAD-D4

The sequence of this isoform differs from the canonical sequence as follows:
     116-160: Missing.

Show »
Length:283
Mass (Da):30,194
Checksum:i77A839A78449DC78
GO
Isoform 5 (identifier: O75771-5) [UniParc]FASTAAdd to basket
Also known as: TRAD-D5

The sequence of this isoform differs from the canonical sequence as follows:
     88-101: SLDKLLDAGLYTGE → RQKLSGGSRWCMHL

Show »
Length:328
Mass (Da):35,214
Checksum:iA494887924CB3834
GO
Isoform 6 (identifier: O75771-6) [UniParc]FASTAAdd to basket
Also known as: TRAD-D6, D7

The sequence of this isoform differs from the canonical sequence as follows:
     88-118: SLDKLLDAGLYTGEVTEIVGGPGSGKTQVCL → RHGGRTQVGTWEDCSCLRSPQGDRGVGSGML
     119-328: Missing.

Show »
Length:118
Mass (Da):12,675
Checksum:iE7A605D379835E0A
GO
Isoform 7 (identifier: O75771-7) [UniParc]FASTAAdd to basket
Also known as: TRAD-D8

The sequence of this isoform differs from the canonical sequence as follows:
     193-212: VTGSSGTVKVVVVDSVTAVV → DGIPEHLNHIPHCLHVHLPC
     213-328: Missing.

Show »
Length:212
Mass (Da):22,975
Checksum:iE2554F3D42E92D58
GO
Isoform 8 (identifier: O75771-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-88: ALVALRRVLL...TAILSTGIGS → TWRAHSSGNL...ERGTAVSTSR

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):37,014
Checksum:i7371C4C9882D629C
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN92K7EN92_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
249Annotation score:
K7EMF1K7EMF1_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
141Annotation score:
K7ESL4K7ESL4_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
93Annotation score:
H0UID0H0UID0_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D hCG_1989222
151Annotation score:
K7ERM7K7ERM7_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
96Annotation score:
K7EKG7K7EKG7_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
107Annotation score:
K7EJ58K7EJ58_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
24Annotation score:
K7ESI1K7ESI1_HUMAN
DNA repair protein RAD51 homolog 4
RAD51D
86Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti231A → V in CAB55937 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0792719C → S1 PublicationCorresponds to variant dbSNP:rs140825795EnsemblClinVar.1
Natural variantiVAR_02056024R → S1 PublicationCorresponds to variant dbSNP:rs28363257EnsemblClinVar.1
Natural variantiVAR_020561165R → Q1 PublicationCorresponds to variant dbSNP:rs4796033EnsemblClinVar.1
Natural variantiVAR_020562225A → T1 PublicationCorresponds to variant dbSNP:rs28363282EnsemblClinVar.1
Natural variantiVAR_020563232R → Q1 PublicationCorresponds to variant dbSNP:rs28363283EnsemblClinVar.1
Natural variantiVAR_020564233E → G1 PublicationCorresponds to variant dbSNP:rs28363284EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04365849 – 88ALVAL…TGIGS → TWRAHSSGNLGGLQLPQVPA GRSWSGVRNALKKAGLGHGG TDGLSLNAFDERGTAVSTSR in isoform 8. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_00555849A → S in isoform 2. Curated1
Alternative sequenceiVSP_00555950 – 328Missing in isoform 2. CuratedAdd BLAST279
Alternative sequenceiVSP_00556050 – 161Missing in isoform 3. CuratedAdd BLAST112
Alternative sequenceiVSP_00556388 – 118SLDKL…TQVCL → RHGGRTQVGTWEDCSCLRSP QGDRGVGSGML in isoform 6. CuratedAdd BLAST31
Alternative sequenceiVSP_00556288 – 101SLDKL…LYTGE → RQKLSGGSRWCMHL in isoform 5. CuratedAdd BLAST14
Alternative sequenceiVSP_005561116 – 160Missing in isoform 4. CuratedAdd BLAST45
Alternative sequenceiVSP_005564119 – 328Missing in isoform 6. CuratedAdd BLAST210
Alternative sequenceiVSP_005565193 – 212VTGSS…VTAVV → DGIPEHLNHIPHCLHVHLPC in isoform 7. CuratedAdd BLAST20
Alternative sequenceiVSP_005566213 – 328Missing in isoform 7. CuratedAdd BLAST116

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15572 mRNA Translation: CAA75681.1
AF034956 mRNA Translation: AAC39719.1
AB013341 mRNA Translation: BAA25914.1
AB016223 mRNA Translation: BAA31747.1
AB016224 mRNA Translation: BAA31748.1
AB016225 mRNA Translation: BAA31749.1
AB018360 mRNA Translation: BAA33779.1
AB018361 mRNA Translation: BAA33780.1
AB018362 mRNA Translation: BAA33781.1
AB018363 mRNA Translation: BAA33782.1
AB020412 mRNA Translation: BAA34690.1
AY623116 Genomic DNA Translation: AAT38112.1
AK296241 mRNA Translation: BAG58959.1
AC022916 Genomic DNA No translation available.
CH471147 Genomic DNA Translation: EAW80181.1
CH471147 Genomic DNA Translation: EAW80184.1
CH471147 Genomic DNA Translation: EAW80196.1
BC014422 mRNA Translation: AAH14422.1
AL117459 mRNA Translation: CAB55937.1
CCDSiCCDS11287.1 [O75771-1]
CCDS11288.1 [O75771-3]
CCDS45646.1 [O75771-8]
PIRiT17247
RefSeqiNP_001136043.1, NM_001142571.1 [O75771-8]
NP_002869.3, NM_002878.3 [O75771-1]
NP_598332.1, NM_133629.2 [O75771-3]
UniGeneiHs.631757

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379 [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379 [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379 [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379 [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379 [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379 [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379 [O75771-8]
GeneIDi5892
KEGGihsa:5892
UCSCiuc002hir.4 human [O75771-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y15572 mRNA Translation: CAA75681.1
AF034956 mRNA Translation: AAC39719.1
AB013341 mRNA Translation: BAA25914.1
AB016223 mRNA Translation: BAA31747.1
AB016224 mRNA Translation: BAA31748.1
AB016225 mRNA Translation: BAA31749.1
AB018360 mRNA Translation: BAA33779.1
AB018361 mRNA Translation: BAA33780.1
AB018362 mRNA Translation: BAA33781.1
AB018363 mRNA Translation: BAA33782.1
AB020412 mRNA Translation: BAA34690.1
AY623116 Genomic DNA Translation: AAT38112.1
AK296241 mRNA Translation: BAG58959.1
AC022916 Genomic DNA No translation available.
CH471147 Genomic DNA Translation: EAW80181.1
CH471147 Genomic DNA Translation: EAW80184.1
CH471147 Genomic DNA Translation: EAW80196.1
BC014422 mRNA Translation: AAH14422.1
AL117459 mRNA Translation: CAB55937.1
CCDSiCCDS11287.1 [O75771-1]
CCDS11288.1 [O75771-3]
CCDS45646.1 [O75771-8]
PIRiT17247
RefSeqiNP_001136043.1, NM_001142571.1 [O75771-8]
NP_002869.3, NM_002878.3 [O75771-1]
NP_598332.1, NM_133629.2 [O75771-3]
UniGeneiHs.631757

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ3NMR-A1-83[»]
ProteinModelPortaliO75771
SMRiO75771
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111829, 41 interactors
CORUMiO75771
DIPiDIP-24265N
IntActiO75771, 55 interactors
MINTiO75771
STRINGi9606.ENSP00000466834

PTM databases

iPTMnetiO75771
PhosphoSitePlusiO75771

Polymorphism and mutation databases

BioMutaiRAD51D

Proteomic databases

EPDiO75771
MaxQBiO75771
PaxDbiO75771
PeptideAtlasiO75771
PRIDEiO75771
ProteomicsDBi50183
50184 [O75771-2]
50185 [O75771-3]
50186 [O75771-4]
50187 [O75771-5]
50188 [O75771-6]
50189 [O75771-7]
50190 [O75771-8]

Protocols and materials databases

DNASUi5892
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335858; ENSP00000338408; ENSG00000185379 [O75771-3]
ENST00000345365; ENSP00000338790; ENSG00000185379 [O75771-1]
ENST00000394589; ENSP00000378090; ENSG00000185379 [O75771-1]
ENST00000586044; ENSP00000465584; ENSG00000185379 [O75771-2]
ENST00000587977; ENSP00000466587; ENSG00000185379 [O75771-6]
ENST00000588594; ENSP00000465366; ENSG00000185379 [O75771-2]
ENST00000590016; ENSP00000466399; ENSG00000185379 [O75771-8]
GeneIDi5892
KEGGihsa:5892
UCSCiuc002hir.4 human [O75771-1]

Organism-specific databases

CTDi5892
DisGeNETi5892
EuPathDBiHostDB:ENSG00000185379.20
GeneCardsiRAD51D
HGNCiHGNC:9823 RAD51D
MalaCardsiRAD51D
MIMi602954 gene
614291 phenotype
neXtProtiNX_O75771
OpenTargetsiENSG00000185379
Orphaneti145 Hereditary breast and ovarian cancer syndrome
PharmGKBiPA34179
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
KOG4275 Eukaryota
ENOG41101VR LUCA
GeneTreeiENSGT00860000133731
HOGENOMiHOG000049134
HOVERGENiHBG057455
InParanoidiO75771
KOiK10871
OMAiHVTRDRD
OrthoDBiEOG091G0SEJ
PhylomeDBiO75771

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6796648 TP53 Regulates Transcription of DNA Repair Genes

Miscellaneous databases

GeneWikiiRAD51L3
GenomeRNAii5892
PROiPR:O75771
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185379 Expressed in 128 organ(s), highest expression level in sperm
ExpressionAtlasiO75771 baseline and differential
GenevisibleiO75771 HS

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR020588 RecA_ATP-bd
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRA51D_HUMAN
AccessioniPrimary (citable) accession number: O75771
Secondary accession number(s): B4DJU7
, E1P637, O43537, O60355, O75196, O75847, O75848, O76073, O76085, O94908, Q9UFU5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: November 7, 2018
This is version 180 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again